CNIH Antibody


Immunohistochemistry-Paraffin: CNIH Antibody [NBP1-84422] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

CNIH Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LLAYHIWRYMSRPVMSGPGLYDPTTIMNADILAYCQKEGWCKL
Specificity of human CNIH antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CNIH Protein (NBP1-84422PEP)
Reviewed Applications
Read 1 Review rated 5
NBP1-84422 in the following applications:

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CNIH Antibody

  • CNIH1
  • CNILMGC117156
  • cornichon homolog (Drosophila)
  • T-cell growth-associated molecule 77
  • TGAM77protein cornichon homolog


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IP
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Species: Mu, Ha
Applications: Flow, IHC, IP
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, Simple Western
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CNIH Antibody (NBP1-84422) (0)

There are no publications for CNIH Antibody (NBP1-84422).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for CNIH Antibody (NBP1-84422) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human Retina pigment epithelial cell and Human eye.

Reviews using NBP1-84422:
Filter by Applications
All Applications
Filter by Species
Human Retina pigment epithelial cell and Human eye
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin CNIH NBP1-84422
reviewed by:
IHC-P Human Retina pigment epithelial cell and Human eye 10/03/2017


Sample TestedHuman Retina pigment epithelial cell
SpeciesHuman Retina pigment epithelial cell and Human eye

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CNIH Antibody (NBP1-84422) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CNIH Products

CNIH NBP1-84422

Bioinformatics Tool for CNIH Antibody (NBP1-84422)

Discover related pathways, diseases and genes to CNIH Antibody (NBP1-84422). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CNIH Antibody (NBP1-84422)

Discover more about diseases related to CNIH Antibody (NBP1-84422).

Pathways for CNIH Antibody (NBP1-84422)

View related products by pathway.

Blogs on CNIH

There are no specific blogs for CNIH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Application: IHC-P
Species: Human Retina pigment epithelial cell and Human eye


Gene Symbol CNIH