Home » TARP » TARP Antibodies » TARP Antibody

TARP Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: TARP Antibody [NBP1-74080] - Jurkat Cell Lysate 1ug/ml Gel Concentration 10-20%
Western Blot: TARP Antibody [NBP1-74080] - Jurkat Cell Lysate 1ug/ml Gel Concentration 10-20%

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

TARP Antibody Summary

Immunogen
Synthetic peptides corresponding to the N terminal of TARP. Immunizing peptide sequence YMKFSWLTVPEKSLDKEHRCIVRHENNKNGVDQEIIFPPIKTDVITMDPK.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TARP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TARP and was validated on Western blot.
Theoretical MW
13 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TARP Antibody

  • CD3G
  • TARP TCR gamma alternate reading frame protein
  • TCRG
  • TCRGC1
  • TCRGC2

Background

In some non-lymphoid tissues, the unrearranged T cell receptor gamma (TRG@) locus is expressed. The resulting transcript contains a subset of the TRG@ gene segments and is shorter than TRG@ transcripts expressed in lymphoid tissues. This RefSeq record represents the unrearranged TRG@ locus transcript; the complete TRG@ locus is represented by the genomic RefSeq NG_001336. The transcript represented by this RefSeq has two open reading frames (ORFs) that encode different proteins. The downstream ORF is in the same frame as TRG@ and its protein product is similar to TRG@ proteins. The upstream ORF uses a different reading frame and encodes a novel protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

TRDD3 Antibody
H00028523-B01P
Western Blot: TRDD3 Antibody [H00028523-B01P] - Analysis of TRDD3 expression in human kidney.
Immunocytochemistry/Immunofluorescence: TRDD3 Antibody [H00028523-B01P] - Analysis of purified antibody to TRDD3 on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: TRDD3 Antibody [H00028523-B01P] - Analysis of TRDD3 expression in transfected 293T cell line by TRDD3 polyclonal antibody. Lane 1: TRDD3 transfected lysate(32.67 KDa). Lane 2: Non-transfected lysate.
Species: Hu
Applications: WB, ELISA, ICC/IF
Stargazin Antibody
(S245-36)
NBP2-22411
Western Blot: Stargazin Antibody (S245-36) [NBP2-22411] - analysis of Rat brain lysates showing detection of Stargazin Calcium Channel protein using Mouse Anti-Stargazin Calcium Channel Monoclonal Antibody, Clone S245-36. Primary Antibody: Mouse Anti-Stargazin Calcium Channel Monoclonal Antibody at 1:100, 1:250, 1:500, and 1:1000.
Immunocytochemistry/Immunofluorescence: Stargazin Antibody (S245-36) [NBP2-22411] - Tissue: Neuroblastoma cell line SK-N-BE. Species: Human. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-TARP Gamma2/4/8 (Stargazin) Monoclonal Antibody at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:100 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000, 1:5000 for 60min RT, 5min RT. Localization: Cell Membrane, Nucleus. Magnification: 60X.
Species: Rt
Applications: WB, ICC/IF
TRGV3 Antibody
H00006976-B01P
Western Blot: TRGV3 Antibody [H00006976-B01P] - Analysis of TRGV3 expression in transfected 293T cell line by TRGV3 polyclonal antibody. Lane 1: TRGV3 transfected lysate(22 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: TRGV3 Antibody [H00006976-B01P] - Analysis of purified antibody to TRGV3 on HeLa cell. (antibody concentration 10 ug/ml)
Species: Hu
Applications: WB, ICC/IF
Mouse CD3+ T Cell,
Small Column Enrichme ...
MTCC-10-NOV
Mouse CD3+ T Cell, Small Column Enrichment Kit
CD3 delta Antibody
(JJ08-97)
NBP2-67882
Western Blot: CD3 delta Antibody (JJ08-97) [NBP2-67882] - Analysis of CD3D on Jurkat cells lysates using anti-CD3D antibody at 1/1,000 dilution.
Immunocytochemistry/Immunofluorescence: CD3 delta Antibody (JJ08-97) [NBP2-67882] - Staining CD3D in SW480 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: CD3 delta Antibody (JJ08-97) [NBP2-67882] - Analysis of paraffin-embedded human tonsil tissue using anti-CD3D antibody. Counter stained with hematoxylin.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
CD8 Antibody
(53-6.7)
NBP1-49045
Immunocytochemistry/Immunofluorescence: CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of immersion fixed splenocytes. Primary antibody was used at a dilution of 10 ug/mL and incubated for 3 hours at room temperature.
Immunohistochemistry-Frozen: CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of CD8+ T cells in allogeneic skin grafted onto a mouse.
Flow Cytometry: CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of lymph nodes by multiple staining.
(2 Reviews)
(11 Publications)
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
CD2 Antibody
(RPA-2.10)
NBP2-25200
Flow Cytometry: CD2 Antibody (RPA-2.10) [NBP2-25200] - Analysis using the PE/Cy5 conjugate of NBP2-25200. Staining of normal human peripheral blood cells with Mouse IgG1 kappa Isotype Control PE-Cy5 (open histogram) or Anti-Human CD2 PE-Cy5 (filled histogram). Total cells were used for analysis.
Flow Cytometry: CD2 Antibody (RPA-2.10) [NBP2-25200] - Cell surface analysis of CD2 in 10^6 human lymphocytes using 0.25 ug of CD2 RPA-2.10 antibody; Shaded histogram represents cells without antibody; green represents isotype control ; red represents CD2 antibody. Goat anti-mouse IgG PE conjugated secondary was used in this test.
Flow Cytometry: CD2 Antibody (RPA-2.10) [NBP2-25200] - Analysis using the Alexa Fluor (R) 488 conjugate of NBP2-25200. Staining of CD2 in 10^6 human lymphocytes using 10 ul (0.25 ug) of this antibody. Shaded histogram represents cells without antibody; green represents isotype control ; red represents anti-CD2.
Species: Hu
Applications: WB, Flow, IHC, IHC-Fr, B/N
HMBS Antibody
NBP2-33600
Western Blot: HMBS Antibody [NBP2-33600] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Immunocytochemistry/Immunofluorescence: HMBS Antibody [NBP2-33600] - Staining of human cell line A-431 shows localization to lipid droplets.
Immunohistochemistry-Paraffin: HMBS Antibody [NBP2-33600] - Staining in human bone marrow and cerebral cortex tissues using anti-HMBS antibody. Corresponding HMBS RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
CD20 Antibody
(AISB12)
NBP1-43435
Western Blot: MS4A1/CD20 Antibody (AISB12) [NBP1-43435] - Immunoblot of Balb/c thymus (lane 1) and A20 (lane 2) cell lysates with Anti-Mouse CD20 Purified.
Flow Cytometry: MS4A1/CD20 Antibody (AISB12) [NBP1-43435] - Staining of BALB/c splenocytes with Anti-Mouse CD19 Alexa Fluor (R) 647 and 1.0 micrograms conjugated anti-Mouse CD20 Purified followed by Anti-Rat IgG PE. Quadrant lines represent Rat IgG2a isotype control staining levels and cells in the lymphocyte gate were used for analysis.
(3 Publications)
Species: Hu, Mu
Applications: WB, Flow
CD4 Antibody
NBP1-19371
Western Blot: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in the following cell lysates: 1) human spleen 2) human tonsil 3) human placenta 4) human kidney 5) human liver 6) mouse spleen 7) mouse placenta 8) rat placenta.
Immunocytochemistry/Immunofluorescence: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in Jurkat cells with DyLight 488 (green). Nuclei were counterstained with DAPI (blue).
Immunohistochemistry-Paraffin: CD4 Antibody [NBP1-19371] - Alcohol-fixed paraffin-embedded rat spleen tissue. Dilution 1:150. Image from verified customer review.
(8 Reviews)
(14 Publications)
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
GluR1 [p Ser845]
Antibody
NB300-171
Western Blot: GluR1 [p Ser845] Antibody [NB300-171] - Rat hippocampal lysate showing specific immunolabeling of the ~100k GluR1 protein phosphorylated at Ser845 (Control). The phosphospecificity of this labeling is shown in the second lane (lambda-phosphatase: lambda-Ptase). The blot is identical to the control except that it was incubated in lambda-Ptase (1200 units for 30 min) before being exposed to the GluR1 Ser845 antibody. The immunolabeling is completely eliminated by treatment with lambda-Ptase.
(1 Publication)
Species: Mu, Rt
Applications: WB, IHC, IHC-Fr
hnRNP C1 + C2
Antibody (SN0652)
NBP2-67656
Western Blot: hnRNP C1 + C2 Antibody (SN0652) [NBP2-67656] - Analysis of hnRNP C1+C2 on different lysates using anti-hnRNP C1+C2 antibody at 1/1,000 dilution. Positive control: Lane 1: Hela Lane 2: MCF-7 Lane 3: HepG2
Immunocytochemistry/Immunofluorescence: hnRNP C1 + C2 Antibody (SN0652) [NBP2-67656] - Staining hnRNP C1+C2 in B16-F1 (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: hnRNP C1 + C2 Antibody (SN0652) [NBP2-67656] - Analysis of paraffin-embedded mouse skin tissue using anti-hnRNP C1+C2 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
CD90/Thy1 Antibody
AF2067
Western blot shows lysates of human brain (cortex) tissue, human brain (hippocampus) tissue, and human brain (hypothalamus) tissue. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human/Porcine/Canine CD90/Thy1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2067) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for CD90/Thy1 at approximately 22-30 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
CD90/Thy1 was detected in immersion fixed BG01V human embryonic stem cells using Sheep Anti-Human/Porcine/Canine CD90/Thy1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2067) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
Human mesenchymal stem cells were stained with Sheep Anti-Human/Porcine/Canine CD90/Thy1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2067, filled histogram) or isotype control antibody (Catalog # 5-001-A, open histogram), followed by PE-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # F0126).
(1 Review)
Species: Hu, Po, Ca
Applications: WB, Flow, IHC, CyTOF-ready, ICC
TARP Antibody
NBP1-74080
TARP Antibody
Species: Hu
Applications: WB

Publications for TARP Antibody (NBP1-74080) (0)

There are no publications for TARP Antibody (NBP1-74080).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TARP Antibody (NBP1-74080) (0)

There are no reviews for TARP Antibody (NBP1-74080). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TARP Antibody (NBP1-74080) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Array NBP1-74080

Bioinformatics Tool for TARP Antibody (NBP1-74080)

Discover related pathways, diseases and genes to TARP Antibody (NBP1-74080). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TARP Antibody (NBP1-74080)

Discover more about diseases related to TARP Antibody (NBP1-74080).
 

Pathways for TARP Antibody (NBP1-74080)

View related products by pathway.

PTMs for TARP Antibody (NBP1-74080)

Learn more about PTMs related to TARP Antibody (NBP1-74080).

Blogs on TARP

There are no specific blogs for TARP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TARP Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol TARP
Uniprot