Home » TARP » TARP Antibodies » TARP Antibody

TARP Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: TARP Antibody [NBP1-74080] - Jurkat Cell Lysate. Antibody at 1ug/mL. SDS-PAGE gel oncentration 10-20%.
Western Blot: TARP Antibody [NBP1-74080] - Jurkat Cell Lysate. Antibody at 1ug/mL. SDS-PAGE gel oncentration 10-20%.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

TARP Antibody Summary

Immunogen
Synthetic peptides corresponding to the N terminal of TARP. Immunizing peptide sequence YMKFSWLTVPEKSLDKEHRCIVRHENNKNGVDQEIIFPPIKTDVITMDPK. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TARP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against TARP and was validated on Western blot.
Theoretical MW
13 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TARP Antibody

  • CD3G
  • TARP TCR gamma alternate reading frame protein
  • TCRG
  • TCRGC1
  • TCRGC2

Background

In some non-lymphoid tissues, the unrearranged T cell receptor gamma (TRG@) locus is expressed. The resulting transcript contains a subset of the TRG@ gene segments and is shorter than TRG@ transcripts expressed in lymphoid tissues. This RefSeq record represents the unrearranged TRG@ locus transcript; the complete TRG@ locus is represented by the genomic RefSeq NG_001336. The transcript represented by this RefSeq has two open reading frames (ORFs) that encode different proteins. The downstream ORF is in the same frame as TRG@ and its protein product is similar to TRG@ proteins. The upstream ORF uses a different reading frame and encodes a novel protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

TRDD3 Antibody
H00028523-B01P
Immunocytochemistry/Immunofluorescence: TRDD3 Antibody [H00028523-B01P] - Analysis of purified antibody to TRDD3 on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: TRDD3 Antibody [H00028523-B01P] - Analysis of TRDD3 expression in transfected 293T cell line by TRDD3 polyclonal antibody. Lane 1: TRDD3 transfected lysate(32.67 KDa). Lane 2: Non-transfected lysate.
Western Blot: TRDD3 Antibody [H00028523-B01P] - Analysis of TRDD3 expression in human kidney.
Species: Hu
Applications: ICC/IF, WB
Stargazin Antibody
(S245-36)
NBP2-22411
Immunocytochemistry/Immunofluorescence: Stargazin Antibody (S245-36) [NBP2-22411] - Tissue: Neuroblastoma cell line SK-N-BE. Species: Human. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-TARP Gamma2/4/8 (Stargazin) Monoclonal Antibody at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:100 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000, 1:5000 for 60min RT, 5min RT. Localization: Cell Membrane, Nucleus. Magnification: 60X.
Western Blot: Stargazin Antibody (S245-36) [NBP2-22411] - analysis of Rat brain lysates showing detection of Stargazin Calcium Channel protein using Mouse Anti-Stargazin Calcium Channel Monoclonal Antibody, Clone S245-36 . Primary Antibody: Mouse Anti-Stargazin Calcium Channel Monoclonal Antibody at 1:100, 1:250, 1:500, and 1:1000.
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
TRGV3 Antibody
H00006976-B01P
Western Blot: TRGV3 Antibody [H00006976-B01P] - Analysis of TRGV3 expression in transfected 293T cell line by TRGV3 polyclonal antibody. Lane 1: TRGV3 transfected lysate(22 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: TRGV3 Antibody [H00006976-B01P] - Analysis of purified antibody to TRGV3 on HeLa cell. (antibody concentration 10 ug/ml)
Species: Hu
Applications: ICC/IF, WB
Mouse CD3+ T Cell,
Small Column Enrichme ...
MTCC-10-NOV
Mouse CD3+ T Cell, Small Column Enrichment Kit
Species: Mu
CD3 delta Antibody
(2R1O10)
NBP3-16881
Immunohistochemistry: CD3 delta Antibody (2R1O10) [NBP3-16881] - Immunofluorescence analysis of rat spleen using CD3 delta Rabbit mAb (NBP3-16881) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry: CD3 delta Antibody (2R1O10) [NBP3-16881] - Immunofluorescence analysis of mouse spleen using CD3 delta Rabbit mAb (NBP3-16881) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Western Blot: CD3 delta Antibody (2R1O10) [NBP3-16881] - Western blot analysis of extracts of Jurkat cells, using CD3 delta Rabbit mAb (NBP3-16881) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, WB
Kallikrein 3/PSA
[HRP]
DKK300
(1 Review)
(15 Publications)
Species: Hu
Applications: ELISA
CD8 Antibody
(53-6.7) - BSA Free
NBP1-49045
Immunohistochemistry-Paraffin: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - CD8 alpha expression in mouse spleen tissue using anti-CD8 alpha antibody. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of bone marrow tissue by single and multiple staining.
Immunohistochemistry-Frozen: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of mosue spleen sections. CD8+ lymphocytes are marked by brown labeling of the cell surface.
(3 Reviews)
(17 Publications)
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
CD2 Antibody
(RPA-2.10)
NBP2-25200
Flow Cytometry: CD2 Antibody (RPA-2.10) [NBP2-25200] - Analysis using the PE/Cy5 conjugate of NBP2-25200. Staining of normal human peripheral blood cells with Mouse IgG1 kappa Isotype Control PE-Cy5 (open histogram) or Anti-Human CD2 PE-Cy5 (filled histogram). Total cells were used for analysis.
Flow Cytometry: CD2 Antibody (RPA-2.10) [NBP2-25200] - Analysis using the Alexa Fluor (R) 488 conjugate of NBP2-25200. Staining of CD2 in 10^6 human lymphocytes using 10 ul (0.25 ug) of this antibody. Shaded histogram represents cells without antibody; green represents isotype control ; red represents anti-CD2.
Flow Cytometry: CD2 Antibody (RPA-2.10) [NBP2-25200] - Analysis using the Allophycocyanin conjugate of NBP2-25200. Staining of normal human peripheral blood cells with Mouse IgG1 kappa Isotype Control APC (open histogram) or Anti-Human CD2 APC (filled histogram). Cells in the lymphocyte gate were used for analysis.
(1 Review)
Species: Hu
Applications: B/N, Flow, IHC, IHC-Fr, WB
HMBS Antibody
NBP2-33600
Immunohistochemistry-Paraffin: HMBS Antibody [NBP2-33600] - Staining of human bone marrow shows high expression.
Immunohistochemistry-Paraffin: HMBS Antibody [NBP2-33600] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: HMBS Antibody [NBP2-33600] - Staining in human bone marrow and cerebral cortex tissues using anti-HMBS antibody. Corresponding HMBS RNA-seq data are presented for the same tissues.
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
CD20 Antibody
(AISB12) - BSA Free
NBP1-43435
Western Blot: MS4A1/CD20 Antibody (AISB12) [NBP1-43435] - Immunoblot of Balb/c thymus (lane 1) and A20 (lane 2) cell lysates with Anti-Mouse CD20 Purified.
Flow Cytometry: MS4A1/CD20 Antibody (AISB12) [NBP1-43435] - Staining of BALB/c splenocytes with Anti-Mouse CD19 Alexa Fluor (R) 647 and 1.0 micrograms conjugated anti-Mouse CD20 Purified followed by Anti-Rat IgG PE. Quadrant lines represent Rat IgG2a isotype control staining levels and cells in the lymphocyte gate were used for analysis.
(3 Publications)
Species: Hu, Mu
Applications: Flow, WB
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen: CD4 Antibody [NBP1-19371] - Staining in mouse liver tissue.
Immunohistochemistry-Paraffin: CD4 Antibody [NBP1-19371] - Alcohol-fixed paraffin-embedded rat spleen tissue. Dilution 1:150. Image from verified customer review.
Flow Cytometry: CD4 Antibody [NBP1-19371] - An intracellular stain was performed on Jurkat cells with CD4 Antibody NBP1-19371R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 550.
(9 Reviews)
(37 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
GluR1 Antibody
(SD2010)
NBP2-67737
Immunohistochemistry-Paraffin: GluR1 Antibody (SD2010) [NBP2-67737] - Analysis of paraffin-embedded mouse brain tissue using anti-GluR1 antibody. Counter stained with hematoxylin.
Immunohistochemistry-Paraffin: GluR1 Antibody (SD2010) [NBP2-67737] - Analysis of paraffin-embedded rat brain tissue using anti-GluR1 antibody. Counter stained with hematoxylin.
Immunohistochemistry-Paraffin: GluR1 Antibody (SD2010) [NBP2-67737] - Analysis of paraffin-embedded rat cerebellum tissue using anti-GluR1 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
hnRNP C1 + C2
Antibody (SN0652)
NBP2-67656
Flow Cytometry: hnRNP C1 + C2 Antibody (SN0652) [NBP2-67656] - Analysis of Hela cells with hnRNP C1+C2 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody
Immunocytochemistry/Immunofluorescence: hnRNP C1 + C2 Antibody (SN0652) [NBP2-67656] - Staining hnRNP C1+C2 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: hnRNP C1 + C2 Antibody (SN0652) [NBP2-67656] - Staining hnRNP C1+C2 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, WB
CD90/Thy1 Antibody
(OX-7) - BSA Free
NB100-65543
Flow Cytometry: CD90/Thy1 Antibody (OX-7) [NB100-65543] - Staining of rat thymus with MOUSE ANTI RAT CD90 (THY 1.1).
Flow Cytometry: CD90/Thy1 Antibody (OX-7) [NB100-65543] - Staining of rat thymocytes.
Flow Cytometry: CD90/Thy1 Antibody (OX-7) [NB100-65543] - Staining of rat thymocytes.
(12 Publications)
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, WB

Publications for TARP Antibody (NBP1-74080) (0)

There are no publications for TARP Antibody (NBP1-74080).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TARP Antibody (NBP1-74080) (0)

There are no reviews for TARP Antibody (NBP1-74080). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TARP Antibody (NBP1-74080) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TARP Products

Array NBP1-74080

Bioinformatics Tool for TARP Antibody (NBP1-74080)

Discover related pathways, diseases and genes to TARP Antibody (NBP1-74080). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TARP Antibody (NBP1-74080)

Discover more about diseases related to TARP Antibody (NBP1-74080).
 

Pathways for TARP Antibody (NBP1-74080)

View related products by pathway.

PTMs for TARP Antibody (NBP1-74080)

Learn more about PTMs related to TARP Antibody (NBP1-74080).

Blogs on TARP

There are no specific blogs for TARP, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TARP Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol TARP
Uniprot