CLS1 Antibody - Azide and BSA Free

Western Blot: CLS1 Antibody [NBP3-03235] - Analysis of extracts of mouse liver, using CLS1 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CLS1 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit CLS1 Antibody - Azide and BSA Free (NBP3-03235) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human CLS1 (NP_061968.1). MLALRVARGSWGALRGAAWAPGTRPSKRRACWALLPPVPCCLGCLAERWRLRPAALGLRLPGIGQRNHCSGAGKAAPRPAAGAGAAAEAPGGQWGPASTPSLYENPWTIP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CRLS1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:200-1:500

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for CLS1 Antibody - Azide and BSA Free

• cardiolipin synthase 1
• cardiolipin synthase
• CLS
• dJ967N21.6

Background

The function of this protein is still unknown. The gene of human hypothetical protein (LOC54675) is up-regulated in colon cancer metastasis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: CRLS1