CLOCK Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CLOCK Antibody [NBP1-88615] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: CLOCK Antibody [NBP1-88615] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CLOCK Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSSNIQQLAPINMQGQVVPTNQIQSGMNTGHIGTTQHMIQQQTLQSTSTQSQQNVLSGHSQQTSLPSQTQSTLTAPLYNTMVISQPAAGSMVQIPSSMPQNSTQS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CLOCK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CLOCK Protein (NBP1-88615PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CLOCK Antibody

  • BHLHE8
  • circadian locomoter output cycles protein kaput
  • Class E basic helix-loop-helix protein 8
  • clock (mouse) homolog
  • clock homolog (mouse)
  • CLOCK
  • EC 2.3.1.48
  • hCLOCK
  • KAT13D
  • KIAA0334bHLHe8circadian locomoter output cycles kaput protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2288
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24589
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, IHC-P
NB100-125
Species: Hu
Applications: WB, ICC/IF
NBP1-86692
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-40853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00001195-B01P
Species: Hu
Applications: WB, ICC/IF
AF3764
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-31363
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-00749
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00008863-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-88027
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
NBP1-23000
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-31470
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-76701
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1800
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-P, IP

Publications for CLOCK Antibody (NBP1-88615) (0)

There are no publications for CLOCK Antibody (NBP1-88615).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLOCK Antibody (NBP1-88615) (0)

There are no reviews for CLOCK Antibody (NBP1-88615). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CLOCK Antibody (NBP1-88615) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CLOCK Products

Bioinformatics Tool for CLOCK Antibody (NBP1-88615)

Discover related pathways, diseases and genes to CLOCK Antibody (NBP1-88615). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLOCK Antibody (NBP1-88615)

Discover more about diseases related to CLOCK Antibody (NBP1-88615).
 

Pathways for CLOCK Antibody (NBP1-88615)

View related products by pathway.

PTMs for CLOCK Antibody (NBP1-88615)

Learn more about PTMs related to CLOCK Antibody (NBP1-88615).

Blogs on CLOCK

There are no specific blogs for CLOCK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CLOCK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CLOCK
Entrez