CLN6 Antibody

Western Blot: CLN6 Antibody [NBP1-59415] - Titration: 0.2-1 ug/ml, Positive Control: 293T cell lysate.

Immunocytochemistry/Immunofluorescence: CLN6 Antibody [NBP1-59415] - Formalin Fixed Paraffin; Embedded Tissue: Human Pineal Tissue; Observed Staining: Cytoplasmic in cell bodies of pinealocytes; Primary Antibody Concentration: 1:100

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

CLN6 Antibody Summary

• Immunogen: Synthetic peptides corresponding to CLN6(ceroid-lipofuscinosis, neuronal 6, late infantile, variant) The peptide sequence was selected from the C terminal of CLN6 (NP_060352). Peptide sequence RLFLDSNGLFLFSSFALTLLLVALWVAWLWNDPVLRKKYPGVIYVPEPWA. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CLN6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Theoretical MW: 36 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CLN6 Antibody

• ceroid-lipofuscinosis neuronal protein 6
• ceroid-lipofuscinosis, neuronal 6, late infantile, variant
• FLJ20561
• HsT18960
• nclf
• Protein CLN6

Background

CLN6 is one of eight which have been associated with neuronal ceroid lipofuscinoses (NCL). Also referred to as Batten disease, NCL comprises a class of autosomal recessive, neurodegenerative disorders affecting children. The genes responsible likely CLN6 involved in the degradation of post-translationally modified proteins in lysosomes. The primary defect in NCL disorders is thought to be associated with lysosomal storage function.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CLN6
• Entrez:
  • 54982(Human)
• Uniprot:
  • Q9NWW5(Human)