MFSD8 Antibody - BSA Free

Immunohistochemistry-Paraffin: MFSD8 Antibody [NBP1-92114] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: MFSD8 Antibody [NBP1-92114] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: MFSD8 Antibody [NBP1-92114] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.

Staining of human lymphoid tissues shows strong membranous-cytoplasmic positivity in germinal center cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MFSD8 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MFSD8 Antibody - BSA Free (NBP1-92114) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MAGLRNESEQEPLLGDTPGSREWDILETEEHYKSRWR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MFSD8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100.
• Control Peptide:

  MFSD8 Protein (NBP1-92114PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MFSD8 Antibody - BSA Free

• ceroid-lipofuscinosis, neuronal 7, late infantile, variant
• CLN7
• major facilitator superfamily domain containing 8
• major facilitator superfamily domain-containing protein 8
• MGC33302neuronal 7, late infantile

Background

MFSD8 encodes a ubiquitous integral membrane protein that contains a transporter domain and a major facilitator superfamily (MFS) domain. Other members of the major facilitator superfamily transport small solutes through chemiosmotic ion gradients. The substrate transported by this protein is unknown. The protein likely localizes to lysosomal membranes. Mutations in this gene are correlated with a variant form of late infantile-onset neuronal ceroid lipofuscinoses (vLINCL).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MFSD8