MFSD8 Antibody

Western Blot: MFSD8 Antibody [NBP1-92114] - Analysis in control (vector only transfected HEK293T lysate) and MFSD8 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: MFSD8 Antibody [NBP1-92114] - Staining of human cell line U-251 MG shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: MFSD8 Antibody [NBP1-92114] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: MFSD8 Antibody [NBP1-92114] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: MFSD8 Antibody [NBP1-92114] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

MFSD8 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MAGLRNESEQEPLLGDTPGSREWDILETEEHYKSRWR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MFSD8
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100.
• Control Peptide:

  MFSD8 Protein (NBP1-92114PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MFSD8 Antibody

• ceroid-lipofuscinosis, neuronal 7, late infantile, variant
• CLN7
• major facilitator superfamily domain containing 8
• major facilitator superfamily domain-containing protein 8
• MGC33302neuronal 7, late infantile

Background

MFSD8 encodes a ubiquitous integral membrane protein that contains a transporter domain and a major facilitator superfamily (MFS) domain. Other members of the major facilitator superfamily transport small solutes through chemiosmotic ion gradients. The substrate transported by this protein is unknown. The protein likely localizes to lysosomal membranes. Mutations in this gene are correlated with a variant form of late infantile-onset neuronal ceroid lipofuscinoses (vLINCL).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MFSD8