CLIP4 Antibody - BSA Free

Western Blot: CLIP4 Antibody [NBP1-91793] - Analysis in human cell line A-431.

Immunocytochemistry/Immunofluorescence: CLIP4 Antibody [NBP1-91793] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.

Immunohistochemistry-Paraffin: CLIP4 Antibody [NBP1-91793] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.

Staining of human liver shows no positivity in hepatocytes as expected.

Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.

Staining of human heart muscle shows weak cytoplasmic positivity in cardiomyocytes.

Analysis in human cell line A-431.

Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CLIP4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CLIP4 Antibody - BSA Free (NBP1-91793) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TIEDLPDFPLEGNPLFGRYPFIFSASDTPVIFSISAAPMPSDCEFSFFDPNDASCQEIL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CLIP4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CLIP4 Protein (NBP1-91793PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CLIP4 Antibody - BSA Free

• CAP-GLY domain containing linker protein family, member 4
• CAP-Gly domain-containing linker protein 4
• FLJ21069
• FLJ32705
• restin-like 2
• Restin-like protein 2
• RSNL2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CLIP4