CLIC2 Antibody

Images

 
Western Blot: CLIC2 Antibody [NBP2-32516] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: CLIC2 Antibody [NBP2-32516] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CLIC2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LEQTLAPPRYPHLSPKYKESFDVGCNLFAKF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CLIC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CLIC2 Protein (NBP2-32516PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CLIC2 Antibody

  • chloride intracellular channel 2
  • chloride intracellular channel protein 2
  • XAP121CLIC2b

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001192-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-90091
Species: Hu
Applications: IHC, IHC-P
NB300-543
Species: Hu, Mu, Rt, Am, Bv, Ca, Ft, Fi, Pm, Rb, Sh
Applications: WB, B/N, IHC, IHC-Fr, IHC-P, IP, IF
NBP2-56481
Species: Hu
Applications: ICC/IF
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-85574
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4377
Species: Hu, Mu
Applications: WB, ICC
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP2-58121
Species: Hu
Applications: ICC/IF
AF284
Species: Hu
Applications: WB, Flow, CyTOF-ready, Neut
NBP1-57838
Species: Hu
Applications: WB, IHC, IHC-P
H00053405-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89465
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-01798
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
NBP2-32516
Species: Hu, Rt
Applications: WB, IHC, IHC-P

Publications for CLIC2 Antibody (NBP2-32516) (0)

There are no publications for CLIC2 Antibody (NBP2-32516).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLIC2 Antibody (NBP2-32516) (0)

There are no reviews for CLIC2 Antibody (NBP2-32516). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CLIC2 Antibody (NBP2-32516) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CLIC2 Products

Bioinformatics Tool for CLIC2 Antibody (NBP2-32516)

Discover related pathways, diseases and genes to CLIC2 Antibody (NBP2-32516). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLIC2 Antibody (NBP2-32516)

Discover more about diseases related to CLIC2 Antibody (NBP2-32516).
 

Pathways for CLIC2 Antibody (NBP2-32516)

View related products by pathway.

PTMs for CLIC2 Antibody (NBP2-32516)

Learn more about PTMs related to CLIC2 Antibody (NBP2-32516).

Blogs on CLIC2

There are no specific blogs for CLIC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CLIC2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CLIC2