CLECL1 Antibody

Images

 
Western Blot: CLECL1 Antibody [NBP1-54397] - Titration: 0.2-1 ug/ml, Positive Control: Human Placenta.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CLECL1 Antibody Summary

Immunogen
Synthetic peptides corresponding to CLECL1(C-type lectin-like 1) The peptide sequence was selected from the middle region of CLECL1. Peptide sequence FSLFLICAMAGDVVYADIKTVRTSPLELAFPLQRSVSFNFSTVHKSCPAK.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CLECL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CLECL1 and was validated on Western blot.
Theoretical MW
19 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CLECL1 Antibody

  • CLECL1
  • C-type lectin-like 1
  • C-type lectin-like domain family 1
  • DCAL1
  • DCAL-1
  • DCAL1dendritic cell associated lectin 1
  • DC-Associated Lectin-1
  • Dendritic Cell-Associated Lectin 1
  • dendritic cell-associated lectin-1
  • type II transmembrane protein DCAL1

Background

DCAL1 is a type II transmembrane, C-type lectin-like protein expressed on dendritic cells (DCs) and B cells. It interacts with subsets of T cells as a costimulatory molecule that enhances interleukin-4 (IL4; MIM 147780) production. DCAL1 is a type II transmembrane, C-type lectin-like protein expressed on dendritic cells (DCs) and B cells. It interacts with subsets of T cells as a costimulatory molecule that enhances interleukin-4 (IL4; MIM 147780) production.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-504 AF518873.1 1-504 505-649 AW237307.1 1-145 c

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83093
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32020
Species: Hu
Applications: IHC, IHC-P
NBP1-21398
Species: Hu, Mu
Applications: WB, IHC-P, IP, IF
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-21399
Species: Hu
Applications: WB (-), ICC/IF, IHC-P, IP
AF6466
Species: Hu
Applications: WB
MAB25031
Species: Hu
Applications: WB, IHC, IP
MAB161
Species: Hu
Applications: WB, Flow, IHC, AdBlk, CyTOF-ready, ICC
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-82614
Species: Hu
Applications: IHC, IHC-P
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-56841
Species: Hu
Applications: WB, ICC/IF
NBP1-54397
Species: Hu
Applications: WB

Publications for CLECL1 Antibody (NBP1-54397) (0)

There are no publications for CLECL1 Antibody (NBP1-54397).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLECL1 Antibody (NBP1-54397) (0)

There are no reviews for CLECL1 Antibody (NBP1-54397). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CLECL1 Antibody (NBP1-54397) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CLECL1 Products

CLECL1 NBP1-54397

Bioinformatics Tool for CLECL1 Antibody (NBP1-54397)

Discover related pathways, diseases and genes to CLECL1 Antibody (NBP1-54397). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLECL1 Antibody (NBP1-54397)

Discover more about diseases related to CLECL1 Antibody (NBP1-54397).
 

Pathways for CLECL1 Antibody (NBP1-54397)

View related products by pathway.

PTMs for CLECL1 Antibody (NBP1-54397)

Learn more about PTMs related to CLECL1 Antibody (NBP1-54397).

Blogs on CLECL1

There are no specific blogs for CLECL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CLECL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CLECL1
Entrez
Uniprot