CLEC3B/Tetranectin Antibody (3E5Y7)

Western Blot: CLEC3B/Tetranectin Antibody (3E5Y7) [NBP3-16399] - Western blot analysis of extracts of various cell lines, using CLEC3B/CLEC3B/Tetranectin Rabbit mAb (NBP3-16399) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunocytochemistry/Immunofluorescence: CLEC3B/Tetranectin Antibody (3E5Y7) [NBP3-16399] - Immunofluorescence analysis of C6 cells using CLEC3B/CLEC3B/Tetranectin Rabbit mAb (NBP3-16399) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: CLEC3B/Tetranectin Antibody (3E5Y7) [NBP3-16399] - Immunofluorescence analysis of NIH-3T3 cells using CLEC3B/CLEC3B/Tetranectin Rabbit mAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clone: 3E5Y7
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

CLEC3B/Tetranectin Antibody (3E5Y7) Summary

• Description: Novus Biologicals Rabbit CLEC3B/Tetranectin Antibody (3E5Y7) (NBP3-16399) is a recombinant monoclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 103-202 of human CLEC3B/Tetranectin (P05452). GTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: CLEC3B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CLEC3B/Tetranectin Antibody (3E5Y7)

• CLEC3B
• C-type lectin domain family 3 member B
• C-type lectin domain family 3, member B
• DKFZp686H17246
• Plasminogen kringle 4-binding protein
• TETN
• tetranectin (plasminogen binding protein)
• Tetranectin
• TNA
• TNAtetranectin (plasminogen-binding protein)
• TNtetranectin

Background

Tetranectin (TN) is a serum and tissue protein, a C-type lectin, which binds to Ca++. It is a homotrimer of monomers each with a mass of 20 kDa, plasma or serum concentrations of TN are found to be approximately 10 mg/l (1,2,4). In vitro, TN can bind to kringle 4 of plasminogen and enhance the activation of plaminogen to plasmin, catalyzed by tissue plasminogen activator in the presence of poly-D-lysine (3). TN is best known as a prognostic marker in ovarian cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CLEC3B