CLEC-2/CLEC-1B Antibody - BSA Free

Staining of human bone marrow shows moderate cytoplasmic positivity in hematopoietic cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CLEC-2/CLEC-1B Antibody - BSA Free Summary

• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein CLEC-2/CLEC-1B using the following amino acid sequence: WSVMQRNYLQDENENRTGTLQQLAKRFCQYVVKQSELKGTFKGHKCSPCDTNWRYYGDSCYGFFRHNLTWEESK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CLEC1B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, we recommend using Heat-Induced Epitope Retrieval (HIER) with a pH level of 6. This optimized retrieval method ensures the best results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CLEC-2/CLEC-1B Antibody - BSA Free

• 1810061I13Rik
• CLEC1B
• CLEC2
• CLEC-2
• CLEC2B
• CLEC2PRO1384
• C-type lectin domain family 1 member B
• C-type lectin domain family 1, member B
• C-type lectin-like receptor 2
• C-type lectin-like receptor-2
• QDED721

Background

Natural killer (NK) cells express multiple calcium-dependent (C-type) lectin-like receptors, such as CD94 (KLRD1; MIM 602894) and NKG2D (KLRC4; MIM 602893), that interact with major histocompatibility complex class I molecules and either inhibit or activate cytotoxicity and cytokine secretion. CLEC2 is a C-type lectin-like receptor expressed in myeloid cells and NK cells.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CLEC1B