CLEC-2/CLEC-1B Antibody - BSA Free Summary
| Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen |
The immunogen for this antibody is Clec1b. Peptide sequence MQDEDGYITLNIKPRKQALSSAEPASSWWRVMALVLLISSMGLVVGLVAL. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CLEC1B |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for CLEC-2/CLEC-1B Antibody - BSA Free
Background
Natural killer (NK) cells express multiple calcium-dependent (C-type) lectin-like receptors, such as CD94 (KLRD1; MIM 602894) and NKG2D (KLRC4; MIM 602893), that interact with major histocompatibility complex class I molecules and either inhibit or activate cytotoxicity and cytokine secretion. CLEC2 is a C-type lectin-like receptor expressed in myeloid cells and NK cells.[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IP
Species: Hu
Applications: Block, CyTOF-ready, Flow
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CostimT, CyTOF-ready, Flow, Neut, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow
Publications for CLEC-2/CLEC-1B Antibody (NBP1-79203) (0)
There are no publications for CLEC-2/CLEC-1B Antibody (NBP1-79203).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CLEC-2/CLEC-1B Antibody (NBP1-79203) (0)
There are no reviews for CLEC-2/CLEC-1B Antibody (NBP1-79203).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CLEC-2/CLEC-1B Antibody (NBP1-79203) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CLEC-2/CLEC-1B Products
Research Areas for CLEC-2/CLEC-1B Antibody (NBP1-79203)
Find related products by research area.
|
Blogs on CLEC-2/CLEC-1B