CLCNKB Antibody

Images

 
Western Blot: CLCNKB Antibody [NBP3-10349] - Western blot analysis using NBP3-10349 on Human kidney as a positive control. Antibody Titration: 0.2-1 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CLCNKB Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CLCNKB (NP_000076). Peptide sequence ILAAGCPTEPVTLKLSPETSLHEAHNLFELLNLHSLFVTSRGRAVGCVSW
Clonality
Polyclonal
Host
Rabbit
Gene
CLCNKB
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
76 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for CLCNKB Antibody

  • chloride channel KbClC-Kb
  • chloride channel protein ClC-Kb
  • chloride channel, kidney, B
  • ClC-K2
  • CLCKB
  • hClC-Kb
  • MGC24087

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-92433
Species: Hu, Mu
Applications: WB
NBP2-49101
Species: Hu
Applications: IHC, IHC-P
NBP1-44270
Species: Mu, Rt
Applications: EM, ICC/IF, IHC, IHC-P, WB
NBP1-82874
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-80993
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF5447
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
NBP1-89926
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-69123
Species: Mu, Rt
Applications: WB
NB120-19347
Species: Bv, Hu, Mu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-91791
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00001180-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
H00001181-M01
Species: Hu
Applications: ELISA, KD, S-ELISA, WB
MAB25031
Species: Hu
Applications: IHC, IP, WB
AF4090
Species: Hu
Applications: IHC, IP, Neut, WB
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-59379
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP3-10349
Species: Hu
Applications: WB

Publications for CLCNKB Antibody (NBP3-10349) (0)

There are no publications for CLCNKB Antibody (NBP3-10349).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLCNKB Antibody (NBP3-10349) (0)

There are no reviews for CLCNKB Antibody (NBP3-10349). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CLCNKB Antibody (NBP3-10349) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CLCNKB Products

Bioinformatics Tool for CLCNKB Antibody (NBP3-10349)

Discover related pathways, diseases and genes to CLCNKB Antibody (NBP3-10349). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLCNKB Antibody (NBP3-10349)

Discover more about diseases related to CLCNKB Antibody (NBP3-10349).
 

Pathways for CLCNKB Antibody (NBP3-10349)

View related products by pathway.

PTMs for CLCNKB Antibody (NBP3-10349)

Learn more about PTMs related to CLCNKB Antibody (NBP3-10349).

Blogs on CLCNKB

There are no specific blogs for CLCNKB, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CLCNKB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CLCNKB