BSND Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101] - Staining in human kidney and liver tissues using NBP2-49101 antibody. Corresponding BSND RNA-seq data are presented for the same ...read more
Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101] - Staining of human salivary gland shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101] - Barttin is expressed by dark cells surrounding the ampulla and utricle in the adult mouse vestibular system. Antibody at 1:1000. Nuclei stained with DAPI. ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101] - Staining of human kidney, liver, salivary gland and skeletal muscle using Anti-BSND antibody NBP2-49101 (A) shows similar ...read more
Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101] - Staining of human liver shows no positivity in hepatocytes as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BSND Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SPQQEPQGCRCPLDRFQDFALIDAPTLEDEPQEGQQWEIALPNNWQRYPRTKVEEKEASDTGGEEPEKEEEDLYYGLPDGAGDL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BSND
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BSND Recombinant Protein Antigen (NBP2-49101PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP2-49101 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2), 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BSND Antibody

  • BARTMGC119284
  • Bartter syndrome, infantile, with sensorineural deafness (Barttin)
  • barttin
  • deafness, autosomal recessive 73
  • DFNB73
  • MGC119283
  • MGC119285

Background

BSND encodes an essential beta subunit for CLC chloride channels. These heteromeric channels localize to basolateral membranes of renal tubules and of potassium-secreting epithelia of the inner ear. Mutations in this gene have been associated with Bartter syndrome with sensorineural deafness.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for BSND Antibody (NBP2-49101) (0)

There are no publications for BSND Antibody (NBP2-49101).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for BSND Antibody (NBP2-49101) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP2-49101:
Filter by Applications
IHC-P
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin BSND NBP2-49101
Enlarge
5
reviewed by:
Edward van Beelen
IHC-P Mouse 06/30/2020
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample TestedMouse inner ear
SpeciesMouse
Lot000009620

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for BSND Antibody (NBP2-49101) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Edward van Beelen
06/30/2020
Application: IHC-P
Species: Mouse

Bioinformatics

Gene Symbol BSND