CLCN3 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit CLCN3 Antibody - BSA Free (NBP2-87193) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of human CLCN3. Peptide sequence: VGDAFGREGIYEAHIRLNGYPFLDAKEEFTHTTLAADVMRPRRNDPPLAVL The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CLCN3 |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot 1.0 ug/ml
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
1 mg/ml |
| Purity |
Protein A purified |
Alternate Names for CLCN3 Antibody - BSA Free
Background
CLCN3 mediates the exchange of chloride ions against protons. Functions as antiporter and contributes to theacidification of the endosome and synaptic vesicle lumen, and may thereby affect vesicle trafficking and exocytosis.May play an important role in n
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, KD, S-ELISA, WB
Species: Mu, Rt
Applications: WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: Flow, IHC, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Mu
Applications: ELISA
Publications for CLCN3 Antibody (NBP2-87193) (0)
There are no publications for CLCN3 Antibody (NBP2-87193).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CLCN3 Antibody (NBP2-87193) (0)
There are no reviews for CLCN3 Antibody (NBP2-87193).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CLCN3 Antibody (NBP2-87193) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CLCN3 Products
Research Areas for CLCN3 Antibody (NBP2-87193)
Find related products by research area.
|
Blogs on CLCN3