Recombinant Human Claudin-6 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Claudin-6 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-220 of Human CLDN6 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAVIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV

Protein/Peptide Type
Recombinant Protein
Gene
CLDN6

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Claudin-6 Protein

  • claudin 6
  • Claudin6
  • Claudin-6
  • CLDN6
  • Skullin 2
  • skullin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00009076-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-41187
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
NB120-15106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00006598-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
MAB4620
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
NBP1-87402
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4280
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-34270
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-60010
Species: Hu
Applications: WB, IHC, IHC-P
MAB5275
Species: Hu
Applications: Flow, CyTOF-ready, ICFlow
NBP1-87450
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33610
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2727
Species: Hu, Po, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-87402
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87528
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92025
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00009074-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for Claudin-6 Recombinant Protein (H00009074-P01) (0)

There are no publications for Claudin-6 Recombinant Protein (H00009074-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Claudin-6 Recombinant Protein (H00009074-P01) (0)

There are no reviews for Claudin-6 Recombinant Protein (H00009074-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Claudin-6 Recombinant Protein (H00009074-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Claudin-6 Products

Bioinformatics Tool for Claudin-6 Recombinant Protein (H00009074-P01)

Discover related pathways, diseases and genes to Claudin-6 Recombinant Protein (H00009074-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Claudin-6 Recombinant Protein (H00009074-P01)

Discover more about diseases related to Claudin-6 Recombinant Protein (H00009074-P01).
 

Pathways for Claudin-6 Recombinant Protein (H00009074-P01)

View related products by pathway.

PTMs for Claudin-6 Recombinant Protein (H00009074-P01)

Learn more about PTMs related to Claudin-6 Recombinant Protein (H00009074-P01).
 

Research Areas for Claudin-6 Recombinant Protein (H00009074-P01)

Find related products by research area.

Blogs on Claudin-6

There are no specific blogs for Claudin-6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Claudin-6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CLDN6
Entrez