Claudin-23 Antibody


Western Blot: CLDN23 Antibody [NBP1-70500] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry-Paraffin: CLDN23 Antibody [NBP1-70500] - Human Placenta Tissue, 5.0ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Claudin-23 Antibody Summary

Synthetic peptides corresponding to CLDN23 (claudin 23) The peptide sequence was selected from the C terminal of CLDN23. Peptide sequence IKYYSDGQHRPPPAQHRKPKPKPKVGFPMPRPRPKAYTNSVDVLDGEGWE.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against CLDN23 and was validated on Western blot.
Theoretical MW
17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Claudin-23 Antibody

  • claudin 23
  • Claudin23
  • Claudin-23
  • CLDN23
  • hCG1646163,2310014B08Rik


CLDN23 is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C. It is a candidate tumor suppressor gene implicated in intestinal-type gastric cancer.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
Species: Hu
Applications: Flow, CyTOF-ready, ICC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: Flow, CyTOF-ready, ICFlow
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: Flow, CyTOF-ready, ICC
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: Flow, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Claudin-23 Antibody (NBP1-70500) (0)

There are no publications for Claudin-23 Antibody (NBP1-70500).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Claudin-23 Antibody (NBP1-70500) (0)

There are no reviews for Claudin-23 Antibody (NBP1-70500). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Claudin-23 Antibody (NBP1-70500) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Claudin-23 Products

Claudin-23 NBP1-70500

Bioinformatics Tool for Claudin-23 Antibody (NBP1-70500)

Discover related pathways, diseases and genes to Claudin-23 Antibody (NBP1-70500). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Claudin-23 Antibody (NBP1-70500)

Discover more about diseases related to Claudin-23 Antibody (NBP1-70500).

Pathways for Claudin-23 Antibody (NBP1-70500)

View related products by pathway.

Blogs on Claudin-23

There are no specific blogs for Claudin-23, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Claudin-23 Antibody and receive a gift card or discount.


Gene Symbol CLDN23