Claudin-2 Antibody - BSA Free

Western Blot: Claudin-2 Antibody [NBP2-82696] - Host: Rabbit. Target Name: CLDN2. Sample Tissue: Human MCF7. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

Claudin-2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Claudin-2 Antibody - BSA Free (NBP2-82696) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human Claudin-2. Peptide sequence: WMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAMSSLACIISVV The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CLDN2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for Claudin-2 Antibody - BSA Free

• claudin 2
• Claudin2
• Claudin-2
• CLDN2
• SP82

Background

The Claudin superfamily consists of many structurally related proteins in humans. These proteins are important structural and functional components of tight junctions in paracellular transport. Claudins are located in both epithelial and endothelial cells in all tight junction-bearing tissues. Three classes of proteinsare known to localize to tight junctions, including the Claudins, Occludin and junction adhesion molecule (JAM). Claudins, which consist of four transmembrane domains and two extracellular loops, make up tight junction strands. Emerging evidence suggests that the Claudin family of proteins regulates transport through tight junctions via differential discrimination for solute size and charge. Claudin expression is often highly restricted to specfic regions of different tissues and may have an important role in transcellular transport through tight junctions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CLDN2