Claudin-18 Recombinant Protein Antigen

Images

 
There are currently no images for Claudin-18 Recombinant Protein Antigen (NBP2-32002PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Claudin-18 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CLDN18.

Source: E. coli

Amino Acid Sequence: MMCIACRGLAPEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDYV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CLDN18
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-32002.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Claudin-18 Recombinant Protein Antigen

  • claudin 18
  • Claudin18
  • Claudin-18
  • CLDN18
  • SFTA5
  • SFTPJ
  • surfactant associated 5
  • surfactant associated protein J
  • surfactant, pulmonary associated protein J

Background

This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. This gene is upregulated in patients with ulcerative colitis and highly overexpressed in infiltrating ductal adenocarcinomas. PKC/MAPK/AP-1 (protein kinase C/mitogen-activated protein kinase/activator protein-1) dependent pathway regulates the expression of this gene in gastric cells. Alternatively spliced transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4219
Species: Hu
Applications: CyTOF-ready, Flow
NBP3-18555
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-92405
Species: Hu, Mu, Rt
Applications: WB
H00009076-M01
Species: Hu, Pm, Mu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NB120-11197
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF (-), IHC, IHC-Fr,  IHC-P, WB
MAB3656
Species: Hu
Applications: CyTOF-ready, Flow, ICC
NBP2-44374
Species: Hu
Applications: Flow, ICC/IF, IF, IHC,  IHC-P, IP, WB
NBP2-15196
Species: Bv(-), Ch, Fe, Hu, Ma, Pm, Mu, Po, Rb, Rt
Applications: DB, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, mIF, WB
NBP1-82470
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
AF1379
Species: Hu
Applications: IHC, WB
NBP2-24583
Species: Bv, Eq, Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC,  IHC-P, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF1126
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NBP1-85047
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-02259
Species: Hu, Mu, Po, Rt
Applications: ICC/IF
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-87402
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, KD, WB
NBP2-67309
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB

Publications for Claudin-18 Recombinant Protein Antigen (NBP2-32002PEP) (0)

There are no publications for Claudin-18 Recombinant Protein Antigen (NBP2-32002PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Claudin-18 Recombinant Protein Antigen (NBP2-32002PEP) (0)

There are no reviews for Claudin-18 Recombinant Protein Antigen (NBP2-32002PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Claudin-18 Recombinant Protein Antigen (NBP2-32002PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Claudin-18 Products

Research Areas for Claudin-18 Recombinant Protein Antigen (NBP2-32002PEP)

Find related products by research area.

Blogs on Claudin-18

There are no specific blogs for Claudin-18, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MUC5AC Antibody (45M1)
NBP2-15196-0.1mg

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Claudin-18 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CLDN18