Recombinant Human Cklfsf8 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Cklfsf8 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 173 of Human CMTM8 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEEPQRARSHTVTTTASSFAENFSTSSSSFAYDREFLRTLPGFLIVAEIVLGLLVWTLIAGTEYFRVPAFGWVMFVAVFYWVLTVFFLIIYITMTYTRIPQVPWTTVGLCFNGSAFVLYLSAAVVDASSVSPERDSHNFNSWAASSFFAFLVTICYAGNTYFSFIAWRSRTIQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
CMTM8

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Cklfsf8 Protein

  • chemokine-like factor super family 8
  • chemokine-like factor superfamily 8
  • Chemokine-like factor superfamily member 8
  • CKLF-like MARVEL transmembrane domain containing 8
  • CKLF-like MARVEL transmembrane domain-containing protein 8
  • CKLFSF8
  • CKLFSF8-V2

Background

This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene is widely expressed in many tissues, but the exact function of the encoded protein is unknown. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-13777
Species: Hu
Applications: IHC, IHC-P
NBP2-56745
Species: Hu
Applications: ICC/IF
H00123920-T01
Species: Hu
NBP2-47503
Species: Hu
Applications: WB, IHC, IHC-P
AF3758
Species: Hu, Mu
Applications: WB, Simple Western, ICC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76786
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF527
Species: Mu
Applications: WB, IHC, Block, ICC
NBP1-85946
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Cklfsf8 Recombinant Protein (H00152189-P02) (0)

There are no publications for Cklfsf8 Recombinant Protein (H00152189-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cklfsf8 Recombinant Protein (H00152189-P02) (0)

There are no reviews for Cklfsf8 Recombinant Protein (H00152189-P02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cklfsf8 Recombinant Protein (H00152189-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cklfsf8 Products

Bioinformatics Tool for Cklfsf8 Recombinant Protein (H00152189-P02)

Discover related pathways, diseases and genes to Cklfsf8 Recombinant Protein (H00152189-P02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cklfsf8 Recombinant Protein (H00152189-P02)

Discover more about diseases related to Cklfsf8 Recombinant Protein (H00152189-P02).
 

Pathways for Cklfsf8 Recombinant Protein (H00152189-P02)

View related products by pathway.

PTMs for Cklfsf8 Recombinant Protein (H00152189-P02)

Learn more about PTMs related to Cklfsf8 Recombinant Protein (H00152189-P02).
 

Research Areas for Cklfsf8 Recombinant Protein (H00152189-P02)

Find related products by research area.

Blogs on Cklfsf8

There are no specific blogs for Cklfsf8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Cklfsf8 Antibody
NBP2-31594

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Cklfsf8 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CMTM8