Cited-2 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Cited-2 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Cited-2
  
  

  Source: E.coli

  Amino Acid Sequence: AFNALMGEHIHYGAGNMNATSGIRHAMGPGTVNGGHPPSALAPAARFNNSQFMGPPVASQGGSLPASMQLQKLNNQYFNHHPYPHNHYMPDLHPAAGHQMNGTNQHFRDCNPKH

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: CITED2
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24742It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Cited-2 Recombinant Protein Antigen

• Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain2,cbp/p300-interacting transactivator 2
• Cited2
• Cited-2
• MRG-1
• MRG1melanocyte-specific gene 1-related gene 1
• MSG1-related gene 1
• MSG-related protein 1
• P35srj

Background

CITED2 is a cAMP-responsive element-binding protein (CBP)/p300 interacting transcriptional modulator. CITED-2 has been proposed as a negative regulator for HIF-1 alpha, as it is thought to interfere with the binding of transcription factors HIF-1a and STAT2 to p300/CBP. Recruitment of CBP/p300 by HIF-1 is essential for the transcriptional response to hypoxia.

CITED 2 antibodies are useful tools for research on hypoxic response mechanisms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CITED2