CISD1 Antibody - BSA Free

Western Blot: CISD1 Antibody - BSA Free [NBP2-92696] - Western blot analysis of various lysates, using CISD1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.

Immunocytochemistry/ Immunofluorescence: CISD1 Antibody - BSA Free [NBP2-92696] - Immunofluorescence analysis of NIH/3T3 cells using CISD1 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: CISD1 Antibody - BSA Free [NBP2-92696] - Immunofluorescence analysis of PC-12 cells using CISD1 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

• Reactivity: Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CISD1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CISD1 Antibody - BSA Free (NBP2-92696) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 29-108 of human CISD1 (NP_060934.1). LAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CISD1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 12 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CISD1 Antibody - BSA Free

• C10orf70
• CDGSH iron sulfur domain 1
• CDGSH iron sulfur domain-containing protein 1
• CDGSH iron-sulfur domain-containing protein 1
• chromosome 10 open reading frame 70
• MDS029
• MGC14684
• mitoNEET
• ZCD1
• zinc finger CDGSH-type domain 1
• zinc finger, CDGSH-type domain 1

Background

CISD1 is a member of the CDGSH domain-containing family and may play a role in the regulation of mitochondrial oxidative capacity (Wiley et al., 2007, 2007 [PubMed 17376863] [PubMed 17584744]).[supplied by OMIM]. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments and orthologous data.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CISD1