Cingulin Antibody

Images

 
Immunohistochemistry-Paraffin: Cingulin Antibody [NBP1-89601] - Staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cingulin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GGDSFGVQIKGANDQGASGALSSDLELPENPYSQVKGFPAPSQSSTSDEEPGAYWNGKLLRSHSQASLAGPGPVDPSNRSNSMLELAPKV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CGN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
136 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Cingulin Protein (NBP1-89601PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cingulin Antibody

  • cingulin
  • DKFZp779N1112
  • KIAA1319

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
NBP1-87402
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-87402
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38696
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
H00009076-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
9134-TN
Species: Hu
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC

Publications for Cingulin Antibody (NBP1-89601) (0)

There are no publications for Cingulin Antibody (NBP1-89601).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cingulin Antibody (NBP1-89601) (0)

There are no reviews for Cingulin Antibody (NBP1-89601). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Cingulin Antibody (NBP1-89601) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cingulin Products

Bioinformatics Tool for Cingulin Antibody (NBP1-89601)

Discover related pathways, diseases and genes to Cingulin Antibody (NBP1-89601). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cingulin Antibody (NBP1-89601)

Discover more about diseases related to Cingulin Antibody (NBP1-89601).
 

Pathways for Cingulin Antibody (NBP1-89601)

View related products by pathway.

PTMs for Cingulin Antibody (NBP1-89601)

Learn more about PTMs related to Cingulin Antibody (NBP1-89601).

Blogs on Cingulin

There are no specific blogs for Cingulin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cingulin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CGN
Entrez
Uniprot