CIN85/SH3KBP1 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: CIN85/SH3KBP1 Antibody [NBP1-85614] - Staining in human lymph node and skeletal muscle tissues using anti-SH3KBP1 antibody. Corresponding SH3KBP1 RNA-seq data ...read more
Independent Antibodies: Western Blot: CIN85/SH3KBP1 Antibody [NBP1-85614] - Analysis using Anti-SH3KBP1 antibody NBP1-85614 (A) shows similar pattern to independent antibody NBP1-85615 (B).
Western Blot: CIN85/SH3KBP1 Antibody [NBP1-85614] - Analysis in human cell line THP-1.
Western Blot: CIN85/SH3KBP1 Antibody [NBP1-85614] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: CIN85/SH3KBP1 Antibody [NBP1-85614] - Staining of human lymph node shows strong cytoplasmic positivity.
Immunohistochemistry-Paraffin: CIN85/SH3KBP1 Antibody [NBP1-85614] - Staining of human skeletal muscle shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CIN85/SH3KBP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: WEGVLNGKTGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKSEGANGTVATAAIQPKKVKGVGFGDIFKDKPIKLRPRSIEVENDFLPVEKTIGKKLPATTATPDSSKTEMDSRTKSKDY
Predicted Species
Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SH3KBP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CIN85/SH3KBP1 Protein (NBP1-85614PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CIN85/SH3KBP1 Antibody

  • C-Cbl-Interacting Protein
  • CD2-binding protein 3
  • CD2BP3
  • CIN85
  • CIN85Cbl-interacting protein of 85 kDa
  • GIG10
  • HSB1
  • HSB-1
  • Human Src family kinase-binding protein 1
  • MIG18
  • migration-inducing gene 18
  • SH3 domain-containing kinase-binding protein 1
  • SH3-domain kinase binding protein 1
  • SH3KBP1
  • Src family kinase-binding protein 1
  • src-related kinase binding protein-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37574
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, WB
236-EG
Species: Hu
Applications: BA
NBP1-90625
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-90201
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP1-86599
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-37585
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF7117
Species: Hu, Mu
Applications: ICC, IHC, WB
H00006456-M01
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, IP, S-ELISA, WB
NBP2-00532
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF3846
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-32665
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-27972
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-15278
Species: Hu
Applications: IHC, IHC-P, WB

Publications for CIN85/SH3KBP1 Antibody (NBP1-85614) (0)

There are no publications for CIN85/SH3KBP1 Antibody (NBP1-85614).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CIN85/SH3KBP1 Antibody (NBP1-85614) (0)

There are no reviews for CIN85/SH3KBP1 Antibody (NBP1-85614). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CIN85/SH3KBP1 Antibody (NBP1-85614) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CIN85/SH3KBP1 Products

Bioinformatics Tool for CIN85/SH3KBP1 Antibody (NBP1-85614)

Discover related pathways, diseases and genes to CIN85/SH3KBP1 Antibody (NBP1-85614). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CIN85/SH3KBP1 Antibody (NBP1-85614)

Discover more about diseases related to CIN85/SH3KBP1 Antibody (NBP1-85614).
 

Pathways for CIN85/SH3KBP1 Antibody (NBP1-85614)

View related products by pathway.

PTMs for CIN85/SH3KBP1 Antibody (NBP1-85614)

Learn more about PTMs related to CIN85/SH3KBP1 Antibody (NBP1-85614).

Blogs on CIN85/SH3KBP1

There are no specific blogs for CIN85/SH3KBP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CIN85/SH3KBP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SH3KBP1