CILP-1 Antibody (2D10)

Images

 
Sandwich ELISA: CILP-1 Antibody (2D10) [H00008483-M03] - Detection limit for recombinant GST tagged CILP is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
2D10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CILP-1 Antibody (2D10) Summary

Immunogen
CILP (NP_003604 129 a.a. - 226 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NCSNYTVRFLCPPGSLRRDTERIWSPWSPWSKCSAACGQTGVQTRTRICLAEMVSLCSEASEEGQHCMGQDCTACDLTCPMGQVNADCDACMCQDFML
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CILP
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CILP-1 Antibody (2D10)

  • cartilage intermediate layer protein 1 C1
  • cartilage intermediate layer protein 1 C2
  • cartilage intermediate layer protein 1
  • cartilage intermediate layer protein, nucleotide pyrophosphohydrolase
  • Cartilage intermediate-layer protein
  • CILP
  • CILP1
  • CILP-1
  • HsT18872

Background

Major alterations in the composition of the cartilage extracellular matrix occur in joint disease, such as osteoarthrosis. This gene encodes the cartilage intermediate layer protein (CILP), which increases in early osteoarthrosis cartilage. The encoded protein was thought to encode a protein precursor for 2 different proteins, namely CILP and a homolog of NTPPHase, however later studies identified no nucleotide pyrophosphatase phosphodiesterase (NPP) activity. One isoform of the protein, CILP-1, functions as an IGF-1 antagonist.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-64779
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P, IP
NBP1-93469
Species: Hu
Applications: IHC, IHC-P
NBP2-27561
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-29950
Species: Hu, Mu
Applications: WB, Flow, IHC-P
AF5945
Species: Hu, Mu, Rt
Applications: WB
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF8218
Species: Hu
Applications: WB, IHC
NBP1-89787
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-32162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
MAB5756
Species: Hu
Applications: Flow
NBP2-38952
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
355-BM/CF
Species: Hu, Mu, Rt

Publications for CILP-1 Antibody (H00008483-M03) (0)

There are no publications for CILP-1 Antibody (H00008483-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CILP-1 Antibody (H00008483-M03) (0)

There are no reviews for CILP-1 Antibody (H00008483-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CILP-1 Antibody (H00008483-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CILP-1 Products

Bioinformatics Tool for CILP-1 Antibody (H00008483-M03)

Discover related pathways, diseases and genes to CILP-1 Antibody (H00008483-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CILP-1 Antibody (H00008483-M03)

Discover more about diseases related to CILP-1 Antibody (H00008483-M03).
 

Pathways for CILP-1 Antibody (H00008483-M03)

View related products by pathway.

PTMs for CILP-1 Antibody (H00008483-M03)

Learn more about PTMs related to CILP-1 Antibody (H00008483-M03).
 

Research Areas for CILP-1 Antibody (H00008483-M03)

Find related products by research area.

Blogs on CILP-1

There are no specific blogs for CILP-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CILP-1 Antibody (2D10) and receive a gift card or discount.

Bioinformatics

Gene Symbol CILP
Entrez
Uniprot