Chymotrypsin-like protease Antibody (10Z4K3)

Western Blot: Chymotrypsin-like protease Antibody (10Z4K3) [NBP3-15845] - Western blot analysis of extracts of various cell lines, using Chymotrypsin-like protease Rabbit mAb (NBP3-15845) at 1:5000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Immunohistochemistry-Paraffin: Chymotrypsin-like protease Antibody (10Z4K3) [NBP3-15845] - Immunohistochemistry of paraffin-embedded mouse pancreas using Chymotrypsin-like protease Rabbit mAb (NBP3-15845) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: Chymotrypsin-like protease Antibody (10Z4K3) [NBP3-15845] - Immunohistochemistry of paraffin-embedded rat pancreas using Chymotrypsin-like protease Rabbit mAb (NBP3-15845) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunocytochemistry/ Immunofluorescence: Chymotrypsin-like protease Antibody (10Z4K3) [Chymotrypsin-like protease] - Confocal imaging of paraffin-embedded Mouse pancreas tissue using Chymotrypsin-like protease Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Immunocytochemistry/ Immunofluorescence: Chymotrypsin-like protease Antibody (10Z4K3) [Chymotrypsin-like protease] - Confocal imaging of paraffin-embedded Rat pancreas tissue using Chymotrypsin-like protease Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Immunocytochemistry/ Immunofluorescence: Chymotrypsin-like protease Antibody (10Z4K3) [Chymotrypsin-like protease] - Confocal imaging of paraffin-embedded Human pancreas tissue using Chymotrypsin-like protease Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clone: 10Z4K3
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Chymotrypsin-like protease Antibody (10Z4K3) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 165-264 of human Chymotrypsin-like protease (P40313). GVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQVIAYN
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: CTRL
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:5000 - 1:8000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Chymotrypsin-like protease Antibody (10Z4K3)

• chymotrypsin-like protease CTRL-1
• chymotrypsin-like
• CTRL1
• EC 3.4.21
• EC 3.4.21.-
• MGC70821

Background

CTRL - chymotrypsin-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CTRL