CHX10 Antibody - Azide and BSA Free Summary
Immunogen |
VSX2 (NP_878314.1, 1 a.a. - 361 a.a.) full-length human protein. MTGKAGEALSKPKSETVAKSTSGGAPARCTGFGIQEILGLNKEPPSSHPRAALDGLAPGHLLAARSVLSPAGVGGMGLLGPGGLPGFYTQPTFLEVLSDPQSVHLQPLGRASGPLDTSQTASSDSEDVSSSDRKMSKSALNQTKKRKKRRHRTIFTSYQLEELEKAFNEAHYPDVYAREMLAMKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVMAEYGLYGAMVRHSIPLPESILKSAKDGIMDSCAPWLLGMHKKSLEAAAESGRKPEGERQALPKLDKMEQDERGPDAQAAISQEELRENSIAVLRAKAQEHSTKVLGTVSGPDSLARSTEKPEEEEAMDEDRPAERLSPPQLEDMA |
Marker |
pan-Bipolar Cell Marker |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Mouse |
Gene |
VSX2 |
Purity |
Protein G purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
This antibody is useful for Western Blot, Functional |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.4) |
Preservative |
No Preservative |
Purity |
Protein G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for CHX10 Antibody - Azide and BSA Free
Background
The CHX10 gene encodes a homeobox protein originally described as a retina-specific transcription factor. Mutations in thisgene are associated with microphthalmia, cataracts and iris abnormalities. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC, ICFlow, Simple Western, WB
Species: Ca, Hu, Pm
Applications: WB
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
Species: Hu, Mu
Applications: ELISA, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Mu
Applications: BA
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IP, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: WB
Publications for CHX10 Antibody (H00338917-B01P) (0)
There are no publications for CHX10 Antibody (H00338917-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CHX10 Antibody (H00338917-B01P) (0)
There are no reviews for CHX10 Antibody (H00338917-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CHX10 Antibody (H00338917-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CHX10 Products
Research Areas for CHX10 Antibody (H00338917-B01P)
Find related products by research area.
|
Blogs on CHX10