CHSS2 Antibody

Images

 
Western Blot: CHSS2 Antibody [NBP1-88087] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunocytochemistry/ Immunofluorescence: CHSS2 Antibody [NBP1-88087] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol, centrosome & vesicles.
Immunohistochemistry-Paraffin: CHSS2 Antibody [NBP1-88087] - Staining of human small intestine shows moderate cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CHSS2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GCTGDHEGVHYSHLELSPGEPVQEGDPHFRSALTAHPVRDPVHMYQLHKAFARAELERTYQEIQELQWEIQNTSHLAVDGDRAAAWPVGIPAPS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHPF
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CHSS2 Protein (NBP1-88087PEP)
Publications
Read Publication using NBP1-88087.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (87%). Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CHSS2 Antibody

  • Chondroitin glucuronyltransferase 2
  • chondroitin polymerizing factor
  • chondroitin sulfate synthase 2
  • Chondroitin-polymerizing factor
  • ChPF
  • CHSY2
  • CSS2FLJ22678
  • EC 2.4.1.175
  • EC 2.4.1.226
  • Glucuronosyl-N-acetylgalactosaminyl-proteoglycan4-beta-N-acetylgalactosaminyltransferase II
  • N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase II
  • N-acetylgalactosaminyltransferase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15899
Species: Hu
Applications: WB, IHC, IHC-P
H00000826-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85626
Species: Hu
Applications: IHC, IHC-P
NBP2-30481
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88086
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81727
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-79818
Species: Hu
Applications: WB
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-87962
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
AF143
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-15675
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
7570-GH
Species: Hu
AF5945
Species: Hu, Mu, Rt
Applications: WB
NBP2-42213
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-88087
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CHSS2 Antibody (NBP1-88087)(1)

Reviews for CHSS2 Antibody (NBP1-88087) (0)

There are no reviews for CHSS2 Antibody (NBP1-88087). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CHSS2 Antibody (NBP1-88087) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CHSS2 Products

Bioinformatics Tool for CHSS2 Antibody (NBP1-88087)

Discover related pathways, diseases and genes to CHSS2 Antibody (NBP1-88087). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CHSS2

There are no specific blogs for CHSS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CHSS2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHPF