Chondroitin sulfate synthase 3 Antibody


Immunohistochemistry-Paraffin: Chondroitin sulfate synthase 3 Antibody [NBP1-85626] Staining of human kidney shows strong cytoplasmic positivity in renal tubules.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

Chondroitin sulfate synthase 3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LVIILFSRDSGQDSSKHIELIKGYQNKYPKAEMTLIPMKGEFSRGLGLEMASAQFDNDTLLLFCDVDLIFR
Specificity of human Chondroitin sulfate synthase 3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Chondroitin sulfate synthase 3 Protein (NBP1-85626PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (89%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Chondroitin sulfate synthase 3 Antibody

  • Carbohydrate synthase 2
  • Chondroitin glucuronyltransferase 3
  • chondroitin sulfate synthase 3
  • Chondroitin synthase 2
  • chondroitin synthase-2
  • CHSY2
  • chSy-2
  • CSS3N-acetylgalactosaminyltransferase 3
  • EC
  • EC
  • Glucuronosyl-N-acetylgalactosaminyl-proteoglycan4-beta-N-acetylgalactosaminyltransferase II
  • N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase 3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Fi, Ha, Pm, Sh
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
Species: Hu, Mu, Ch, Re
Applications: WB
Species: Hu
Applications: WB, ICC/IF

Publications for Chondroitin sulfate synthase 3 Antibody (NBP1-85626) (0)

There are no publications for Chondroitin sulfate synthase 3 Antibody (NBP1-85626).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Chondroitin sulfate synthase 3 Antibody (NBP1-85626) (0)

There are no reviews for Chondroitin sulfate synthase 3 Antibody (NBP1-85626). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Chondroitin sulfate synthase 3 Antibody (NBP1-85626) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Chondroitin sulfate synthase 3 Products

Bioinformatics Tool for Chondroitin sulfate synthase 3 Antibody (NBP1-85626)

Discover related pathways, diseases and genes to Chondroitin sulfate synthase 3 Antibody (NBP1-85626). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Chondroitin sulfate synthase 3 Antibody (NBP1-85626)

Discover more about diseases related to Chondroitin sulfate synthase 3 Antibody (NBP1-85626).

Blogs on Chondroitin sulfate synthase 3

There are no specific blogs for Chondroitin sulfate synthase 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Chondroitin sulfate synthase 3 Antibody and receive a gift card or discount.


Gene Symbol CHSY3