Novus Biologicals products are now on

CSGLCAT Antibody


Immunocytochemistry/ Immunofluorescence: CSGLCAT Antibody [NBP1-88086] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli and cytoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CSGLCAT Antibody [NBP1-88086] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC

Order Details

CSGLCAT Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PCVEAVGERGGPQNPDSRARLDQSDEDFKPRIVPYYRDPNKPYKKVLRTRYIQTELGSRERLLVAVLTSRATLST
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CSGLCAT Protein (NBP1-88086PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CSGLCAT Antibody

  • Chondroitin glucuronyltransferase
  • chondroitin polymerizing factor 2KIAA1402chPF-2
  • Chondroitin synthase 3
  • chondroitin synthase-3
  • ChPF-2
  • CHSY3
  • ChSy-3chondroitin sulfate glucuronyltransferase
  • CSGlcA-T
  • EC
  • N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase


Transfers glucuronic acid (GlcUA) from UDP-GlcUA to N-acetylgalactosamine residues on the non-reducing end of the elongating chondroitin polymer. Has no N-acetylgalactosaminyltransferase activity


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, IP, WB
Species: ChHa, Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB

Publications for CSGLCAT Antibody (NBP1-88086) (0)

There are no publications for CSGLCAT Antibody (NBP1-88086).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CSGLCAT Antibody (NBP1-88086) (0)

There are no reviews for CSGLCAT Antibody (NBP1-88086). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CSGLCAT Antibody (NBP1-88086) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CSGLCAT Antibody and receive a gift card or discount.


Gene Symbol CHPF2