CSGLCAT Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CSGLCAT Antibody [NBP1-88086] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: CSGLCAT Antibody [NBP1-88086] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CSGLCAT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PCVEAVGERGGPQNPDSRARLDQSDEDFKPRIVPYYRDPNKPYKKVLRTRYIQTELGSRERLLVAVLTSRATLST
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHPF2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CSGLCAT Protein (NBP1-88086PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CSGLCAT Antibody

  • Chondroitin glucuronyltransferase
  • chondroitin polymerizing factor 2KIAA1402chPF-2
  • Chondroitin synthase 3
  • chondroitin synthase-3
  • ChPF-2
  • CHSY3
  • ChSy-3chondroitin sulfate glucuronyltransferase
  • CSGLCAT
  • CSGlcA-T
  • EC 2.4.1.226
  • N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88087
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15899
Species: Hu
Applications: WB, IHC, IHC-P
AF6144
Species: Hu
Applications: WB, Simple Western
H00003851-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30481
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89374
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91875
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-36727
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, IP, CyTOF-ready
NBP1-88652
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-56242
Species: Hu
Applications: ICC/IF
NB100-64980
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
7570-GH
Species: Hu
NBP1-91982
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81851
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CSGLCAT Antibody (NBP1-88086) (0)

There are no publications for CSGLCAT Antibody (NBP1-88086).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CSGLCAT Antibody (NBP1-88086) (0)

There are no reviews for CSGLCAT Antibody (NBP1-88086). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CSGLCAT Antibody (NBP1-88086) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CSGLCAT Products

Bioinformatics Tool for CSGLCAT Antibody (NBP1-88086)

Discover related pathways, diseases and genes to CSGLCAT Antibody (NBP1-88086). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CSGLCAT

There are no specific blogs for CSGLCAT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CSGLCAT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHPF2