Chordin-like 2/CHRDL2 Antibody - BSA Free

Staining of human cell line SiHa shows localization to vesicles.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Chordin-like 2/CHRDL2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VWHPAFRAFGPLPCILCTCEDGRQDCQRVTCPTEYPCRHPEKVAGKCCKICPEDKADPGHSEISSTRCPK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CHRDL2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Chordin-like 2/CHRDL2 Antibody - BSA Free

• BNF-1
• Chordin like 2
• Chordin-like 2
• chordin-like protein 2
• CHRDL2

Background

BNF-1, also known as Chordin-Like 2, (CHRDL2), is a glycoprotein that negatively regulates cartilage formation by binding Activin A and BMPs and preventing interaction with their receptors. BNF1 contains three von Willebrand factor type C domains. Alternate splicing of mouse BNF1 generates intracellular as well as secreted variants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CHRDL2