Home » Choline kinase alpha » Choline kinase alpha Antibodies » Choline kinase alpha Antibody

Choline kinase alpha Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Choline kinase alpha Antibody [H00001119-A01] - Analysis of CHKA expression in A-431 (Cat # L015V1).
Western Blot: Choline kinase alpha Antibody [H00001119-A01] - Analysis of CHKA expression in A-431 (Cat # L015V1).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Choline kinase alpha Antibody Summary

Immunogen
CHKA (NP_997634 294 a.a. - 393 a.a.) partial recombinant protein with GST tag. ILLLEGRENSEKQKLMLIDFEYSSYNYRGFDIGNHFCEWMYDYSYEKYPFFRANIRKYPTKKQQLHFISSYLPAFQNDFENLSTEEKSIIKEEMLLEVNR
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
CHKA
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Publications
Read Publication using H00001119-A01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
Whole antisera with 50% Glycerol
Preservative
No Preservative
Purity
Unpurified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Choline kinase alpha Antibody

  • CHETK-alpha
  • CHK
  • choline kinase alpha
  • choline kinase
  • CK
  • CKIethanolamine kinase
  • EC 2.7.1.32
  • EC 2.7.1.82
  • EK
  • Ethanolamine kinase;

Background

The major pathway for the biosynthesis of phosphatidylcholine occurs via the CDP-choline pathway. The protein encoded by this gene is the initial enzyme in the sequence and may play a regulatory role. The encoded protein also catalyzes the phosphorylation of ethanolamine. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Myoglobin Antibody
(SC06-38)
NBP2-67599
Western Blot: Myoglobin Antibody (SC06-38) [NBP2-67599] - Analysis of Myoglobin on human skeletal muscle lysates using anti-Myoglobin antibody at 1/1,000 dilution.
Immunocytochemistry/Immunofluorescence: Myoglobin Antibody (SC06-38) [NBP2-67599] - Staining Myoglobin in C2C12 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Myoglobin Antibody (SC06-38) [NBP2-67599] - Analysis of paraffin-embedded mouse skeletal muscle tissue using anti-Myoglobin antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Sialin/SLC17A5
Antibody
NBP2-20383
Western Blot: SLC17A5 Antibody [NBP2-20383] - Sample (30 ug of whole cell lysate) A: Jurkat 10% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: SLC17A5 Antibody [NBP2-20383] - Sample: HepG2 cells were fixed in -20C 100% MeOH for 5 min. Green: SLC17A5 protein stained by SLC17A5 antibody diluted at 1:500. Blue: Hoechst 33343 staining.
Immunohistochemistry-Paraffin: SLC17A5 Antibody [NBP2-20383] - Immunohistochemical analysis of paraffin-embedded BT474 xenograft, using antibody at 1:500 dilution.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Cytokeratin 20
Antibody (SA35-03)
NBP2-67309
Western Blot: Cytokeratin 20 Antibody (SA35-03) [NBP2-67309] - Analysis of Cytokeratin 20 on different cell lysates using anti-Cytokeratin 20 antibody at 1/1,000 dilution. Positive control: Lane 1: Lovo Lane 2: HCT116 Lane 3: CRC
Immunocytochemistry/Immunofluorescence: Cytokeratin 20 Antibody (SA35-03) [NBP2-67309] - Staining Cytokeratin 20 in CRC cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody (SA35-03) [NBP2-67309] - Analysis of paraffin-embedded rat small intestine tissue using anti-Cytokeratin 20 antibody. Counter stained with hematoxylin.
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Cytokeratin 7
Antibody
NBP1-88080
Western Blot: Cytokeratin 7 Antibody [NBP1-88080] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: Cytokeratin 7 Antibody [NBP1-88080] - Staining in human placenta and skeletal muscle tissues. Corresponding KRT7 RNA-seq data are presented for the same tissues.
Western Blot: Cytokeratin 7 Antibody [NBP1-88080] - Analysis in human cell line SiHa.
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Vimentin Antibody
NB300-223
Immunocytochemistry/Immunofluorescence: Vimentin Antibody [NB300-223] - analysis of HeLa cell culture stained with chicken pAb to vimentin, NB300-223, dilution 1:10,000 in green, and costained with EnCor mouse mAb to actin, dilution 1:500 in red. The blue is DAPI staining of nuclear DNA. The vimentin antibody stains the intermediate filament network while the actin antibody labels the submembranous cytoskeleton, stress fibers, and bundles of actin associated with cell adhesion sites.
Vimentin Antibody [NB300-223] - Analysis of tissue and cell lysates using chicken pAb to Vimentin, NB300-223, dilution 1:5,000 in red. [1] protein standard (red), [2] rat whole brain lysate, [3] HeLa, [4] SH-SY5Y, [5] HEK293, and [6] NIH-3T3 cell lysates. NB300-223 binds to the vimentin protein showing a single band at ~50 kDa. The blot was simultaneously probed with mouse mAb to MAP2C/D, dilution 1:5,000 in green, revealing multiple bands around 280kDa that correspond to full length MAP2A/2B isotypes, and ~70kDa bands which are MAP2C/D isotypes. MAP2 isotypes are seen only in extracts containing neuronal lineage cells.
(1 Review)
(22 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
Cytokeratin 19
Antibody
NB100-687
Western Blot: Cytokeratin 19 Antibody [NB100-687] - Analysis of Cytokeratin 19 in 1. HepG2 and 2. MCF7 lysates.
Immunocytochemistry/Immunofluorescence: Cytokeratin 19 Antibody [NB100-687] - MCF7 cells with FITC (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Immunohistochemistry: Cytokeratin 19 Antibody [NB100-687] - Staining of Cytokeratin 19 in human kidney carcinoma using DAB with hematoxylin counterstain.
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MUC-1 Antibody
(SM3)
NB120-22711
Immunocytochemistry/Immunofluorescence: MUC-1 Antibody (SM3) [NB120-22711] - MCF7 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-MUC1 [SM3] at 5 ug/ml overnight at 4C and detected with an anti-mouse IgG Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: MUC-1 Antibody (SM3) [NB120-22711] - IHC analysis of formalin fixed paraffin embedded tissue section of human breast cancer xenograft using MUC-1 antibody clone SM3 at 1:10 dilution. The xenograft section depicted a very specific and intense signal in the periphery of the cancer cells. The necrotic cells also developed a strong immune-positivity while the tumor stroma as well as the nuclei of cells were negative for immunostaining.
Immunocytochemistry/Immunofluorescence: MUC-1 Antibody (SM3) [NB120-22711] - MUC-1 antibody was tested in MCF7 cells at 10 ug/ml using a Dylight 488 conjugated secondary antibody (Green). Actin (Red) and DNA (Blue) were counterstained using Phalloidin 568 and DAPI.
(11 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
p21/CIP1/CDKN1A
Antibody (WA-1 (HJ21)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1 (HJ21)) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(11 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Albumin Antibody
NB600-41532
Western Blot: Albumin Antibody [NB600-41532] - Analysis using the HRP conjugate of NB600-41532. Detection of Albumin in whole mouse liver extracts. Image courtesy of anonymous customer product review.
(38 Publications)
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
TNF-alpha
[Unconjugated]
210-TA
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(19 Reviews)
(507 Publications)
Species: Hu
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - WB analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-p53 (PAb 240) [NB200-103] at a 1:200 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue).Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(2 Reviews)
(22 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Catalase Antibody
NBP2-24916
Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
ETFA Antibody
NBP1-84854
Western Blot: ETFA Antibody [NBP1-84854] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-ETFA antibody. Remaining relative intensity is presented.
Immunocytochemistry/Immunofluorescence: ETFA Antibody [NBP1-84854] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: ETFA Antibody [NBP1-84854] - Staining of human pancreas shows moderate granular cytoplasmic positivity in exocrine glandular cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Cytokeratin 14
Antibody (LL002)
NBP2-34270
Immunohistochemistry-Paraffin: Cytokeratin 14 Antibody (LL002) [NBP2-34270] - Formalin-fixed, paraffin-embedded prostate stained with Cytokeratin 14 Monoclonal Antibody (LL002).
Immunohistochemistry-Paraffin: Cytokeratin 14 Antibody (LL002) [NBP2-34270] - Formalin-fixed, paraffin-embedded human prostate (10X) stained with Cytokeratin 14 MAb (LL002).
Immunohistochemistry-Paraffin: Cytokeratin 14 Antibody (LL002) [NBP2-34270] - Formalin-fixed, paraffin-embedded human prostate (20X) stained with Cytokeratin 14 MAb (LL002).
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP
Cytokeratin 8
Antibody
NBP2-16094
Western Blot: Cytokeratin 8 Antibody [NBP2-16094] - Wild-type (WT) and Cytokeratin 8 knockout (KO) HeLa cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Cytokeratin 8 antibody. HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: Cytokeratin 8 Antibody [NBP2-16094] - HeLa cells were fixed in iced-cold MeOH for 5 min. Green: KRT8 protein stained by Cytokeratin 8 antibody diluted at 1:500. Blue: Hoechst 33343 staining.
Immunohistochemistry-Paraffin: Cytokeratin 8 Antibody [NBP2-16094] - Immunohistochemical analysis of paraffin-embedded Gastric ca, using antibody at 1:500 dilution.
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
SOD1/Cu-Zn SOD
Antibody
NBP2-24915
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Analysis of SOD in liver lysate of 1) human, 2) mouse and 3) rat using this antibody. 025 ug/ml.
Immunohistochemistry-Paraffin: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Analysis of Superoxide Dismutase 1 in paraffin-embedded formalin-fixed human liver tissue using an isotype control (top) and NBP2-24915 (bottom) at 5 ug/ml.
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
Dystrophin Antibody
NBP1-89953
Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining of human tonsil shows no positivity as expected.
Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining of human heart muscle shows strong membranous positivity in myocytes.
Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining of human skeletal muscle shows strong membranous positivity in myocytes.
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Choline kinase
alpha Antibody
H00001119-A01
Choline kinase alpha Antibody
Species: Hu
Applications: WB, ELISA

Publications for Choline kinase alpha Antibody (H00001119-A01)(1)


Reviews for Choline kinase alpha Antibody (H00001119-A01) (0)

There are no reviews for Choline kinase alpha Antibody (H00001119-A01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Choline kinase alpha Antibody (H00001119-A01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Choline kinase alpha Antibody (H00001119-A01)

Discover related pathways, diseases and genes to Choline kinase alpha Antibody (H00001119-A01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Choline kinase alpha Antibody (H00001119-A01)

Discover more about diseases related to Choline kinase alpha Antibody (H00001119-A01).
 

Pathways for Choline kinase alpha Antibody (H00001119-A01)

View related products by pathway.

PTMs for Choline kinase alpha Antibody (H00001119-A01)

Learn more about PTMs related to Choline kinase alpha Antibody (H00001119-A01).
 

Research Areas for Choline kinase alpha Antibody (H00001119-A01)

Find related products by research area.

Blogs on Choline kinase alpha

There are no specific blogs for Choline kinase alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Choline kinase alpha Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol CHKA
Entrez
Uniprot