CHMP1a Antibody

Images

 
Western Blot: CHMP1a Antibody [H00005119-B01P] - Analysis of CHMP1A expression in transfected 293T cell line by CHMP1A polyclonal antibody. Lane 1: PCOLN3 transfected lysate(21.56 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CHMP1a Antibody Summary

Immunogen
CHMP1A (NP_002759.2, 1 a.a. - 196 a.a.) full-length human protein. MDDTLFQLKFTAKQLEKLAKKAEKDSKAEQAKVKKALLQKNVECARVYAENAIRKKNEGVNWLRMASRVDAVASKVQTAVTMKGVTKNMAQVTKALDKALSTMDLQKVSSVMDRFEQQVQNLDVHTSVMEDSMSSATTLTTPQEQVDSLIMQIAEENGLEVLDQLSQLPEGASAVGESSVRSQEDQLSRRLAALRN
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
CHMP1A
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CHMP1a Antibody

  • CHMP1
  • CHMP1charged multivesicular body protein 1/chromatin modifying protein 1
  • chromatin modifying protein 1A
  • Chromatin-modifying protein 1a
  • hVps46-1
  • KIAA0047charged multivesicular body protein 1a
  • PCOLN3protease, metallo, 1, 33kD
  • procollagen (type III) N-endopeptidase
  • PRSM1CHMP1a
  • Vacuolar protein sorting-associated protein 46-1
  • Vps46-1
  • VPS46A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-57242
Species: Hu
Applications: WB, ICC/IF
AF5650
Species: Hu
Applications: WB, IHC
NBP2-37986
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86745
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89391
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91780
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
NB100-65678
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-90230
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31528
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-20881
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49557
Species: Hu
Applications: IHC, IHC-P
PP-K9814-00
Species: Hu
Applications: WB, IHC, IP
44260002
Species: Hu
Applications: WB, ELISA
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF743
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP1-33748
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-112
Species: Hu, Mu, Rt, Ha, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KO

Publications for CHMP1a Antibody (H00005119-B01P) (0)

There are no publications for CHMP1a Antibody (H00005119-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHMP1a Antibody (H00005119-B01P) (0)

There are no reviews for CHMP1a Antibody (H00005119-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CHMP1a Antibody (H00005119-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CHMP1a Products

Bioinformatics Tool for CHMP1a Antibody (H00005119-B01P)

Discover related pathways, diseases and genes to CHMP1a Antibody (H00005119-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHMP1a Antibody (H00005119-B01P)

Discover more about diseases related to CHMP1a Antibody (H00005119-B01P).
 

Pathways for CHMP1a Antibody (H00005119-B01P)

View related products by pathway.

PTMs for CHMP1a Antibody (H00005119-B01P)

Learn more about PTMs related to CHMP1a Antibody (H00005119-B01P).

Blogs on CHMP1a

There are no specific blogs for CHMP1a, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CHMP1a Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHMP1A
Uniprot