CHIP/STUB1 Antibody - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse CHIP/STUB1 Antibody - Azide and BSA Free (H00010273-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
STUB1 (NP_005852.2, 1 a.a. - 303 a.a.) full-length human protein. MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
STUB1 |
| Purity |
Protein G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This antibody is useful for Western Blot, Functional |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for CHIP/STUB1 Antibody - Azide and BSA Free
Background
STUB1/CHIP is an E3 ubiquitin ligase and co-chaperone of heat-shock protein 70 (Hsp70). STUB1/CHIP interacts with Hsp70 to monitor protein folding and direct misfolded proteins for proteasomal degradation. It has been found to also associate with Hsp90 to remove phosphorylated protein tau, a protein that accumulates in the brains of Alzheimers and Down's syndrome patients. STUB1/CHIP has been reported to also have intrinsic chaperone activity and recognize non-native proteins in response to heat stress. In this way, STUB1/CHIP has been shown to be a direct chaperone for p53. Alternate names for STUB1/CHIP include carboxy terminus of Hsp70-interacting protein, STIP1 homology and U-box containing protein 1, CLL-associated antigen KW-8 antigen, serologically defined colon cancer antigen 7, heat shock protein A binding protein 2, NY-CO-7, HSPABP2, and SDCCAG7.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, WB
Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt
Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, PLA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: BA
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Publications for CHIP/STUB1 Antibody (H00010273-B01P) (0)
There are no publications for CHIP/STUB1 Antibody (H00010273-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CHIP/STUB1 Antibody (H00010273-B01P) (0)
There are no reviews for CHIP/STUB1 Antibody (H00010273-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CHIP/STUB1 Antibody (H00010273-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CHIP/STUB1 Products
Research Areas for CHIP/STUB1 Antibody (H00010273-B01P)
Find related products by research area.
|
Blogs on CHIP/STUB1