Chimaerin 2 Recombinant Protein Antigen

Images

 
There are currently no images for Chimaerin 2 Protein (NBP1-90108PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Chimaerin 2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CHN2.

Source: E. coli

Amino Acid Sequence: ASSNSSLSGSSVSSDAEEYQPPIWKSYLYQLQQEAPRPKRIICPREVENRPKY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CHN2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90108.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Chimaerin 2 Recombinant Protein Antigen

  • ARHGAP3beta chimerin
  • BCH
  • beta-chimaerin
  • beta-chimerin
  • chimerin (chimaerin) 2
  • MGC138360
  • Rho GTPase-activating protein 3
  • RhoGAP3
  • rho-GTPase-activating protein 3

Background

Chimaerin 2 is a protein expressed in the brain and pancreas with two isoforms, measuring 468 and 332 amino acids in length with weights of approximately 54 and 38 kDa respectively. Chimaerin 2 functions as a GTP-ase activating protein for p21-rac, and a deficiency in this protein could lead to tumor progression. Current studies are being done on several diseases and disorders related to this protein including b-cell lymphomas, schizophrenia, sleeping sickness, insulin resistance, diabetic retinopathy, malignant glioma, nephropathy, spasticity, astrocytoma, and breast cancer. Chimaerin 2 has also been shown to have interactions with BAG6, NCK1, RAC1, ERBB3, and EIF3C in pathways such as the Rho GTPase cycle, signal transduction, and regulations of RAC1 activity pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-50465
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC,  IHC-P
NBP2-80662
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP1-47989
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-27104
Species: Hu, Mu, Pm
Applications: IHC,  IHC-P, WB
NBP1-90095
Species: Hu
Applications: IHC,  IHC-P
NBP1-78977
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IM, IP, Simple Western, WB
NBP1-85724
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF4066
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
NBP1-88559
Species: Hu, Rt
Applications: IHC,  IHC-P, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NBP1-58359
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-70411
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-90906
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-16679
Species: Dr, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB300-917
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
NBP1-91942
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NBP1-90108PEP
Species: Hu
Applications: AC

Publications for Chimaerin 2 Protein (NBP1-90108PEP) (0)

There are no publications for Chimaerin 2 Protein (NBP1-90108PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Chimaerin 2 Protein (NBP1-90108PEP) (0)

There are no reviews for Chimaerin 2 Protein (NBP1-90108PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Chimaerin 2 Protein (NBP1-90108PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Chimaerin 2 Products

Research Areas for Chimaerin 2 Protein (NBP1-90108PEP)

Find related products by research area.

Blogs on Chimaerin 2

There are no specific blogs for Chimaerin 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Chimaerin 2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CHN2