Recombinant Human CHD9 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CHD9 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-119 of Human CHD9 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLINLLVAQLNMCYLHTLSLIVLQSIPKTNPMVCFQMYQMAVQCGAIRQLLPFQIKMDLLFTNKDIHTLCIKIKALWHTMTLPYFRPMNNKHSVLHYAHNKTEIISTQGRILLASLKIL

Protein/Peptide Type
Recombinant Protein
Gene
CHD9

Applications/Dilutions

Dilutions
  • Western Blot Western Blot
Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CHD9 Protein

  • AD013
  • ATP-dependent helicase CHD9
  • BC022889
  • CHD-9
  • chromatin remodeling factor CHROM1
  • Chromatin-related mesenchymal modulator
  • Chromatin-remodeling factor CHROM1
  • chromodomain helicase DNA binding protein 9
  • chromodomain-helicase-DNA-binding protein 9
  • ciprofibrate bound protein p240
  • CReMM
  • EC 3.6.1
  • EC 3.6.4.12
  • FLJ12178
  • KIAA0308
  • KISH2
  • Kismet homolog 2
  • Peroxisomal proliferator-activated receptor A-interacting complex 320 kDaprotein
  • PPAR{gamma}-interacting cofactor 320 kDa
  • PPAR-alpha-interacting complex protein 320 kDa
  • PRIC320
  • proteinx0008

Background

CHD9( AAH33770, 1 a.a. - 120 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
AF2667
Species: Hu
Applications: WB, IHC
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB300-561
Species: Hu, Mu, Rt, Po, Bv, Eq, Ha, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56605
Species: Av, Bv, Sh
Applications: WB
AF942
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP2-01860
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC
NBP1-37003
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP2-56244
Species: Hu
Applications: WB, ICC/IF
NB100-563
Species: Hu
Applications: WB, IHC-P, IP
NB100-57521
Species: Hu, Mu
Applications: WB, IP
H00080205-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for CHD9 Recombinant Protein (H00080205-P01) (0)

There are no publications for CHD9 Recombinant Protein (H00080205-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHD9 Recombinant Protein (H00080205-P01) (0)

There are no reviews for CHD9 Recombinant Protein (H00080205-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CHD9 Recombinant Protein (H00080205-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CHD9 Products

Bioinformatics Tool for CHD9 Recombinant Protein (H00080205-P01)

Discover related pathways, diseases and genes to CHD9 Recombinant Protein (H00080205-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHD9 Recombinant Protein (H00080205-P01)

Discover more about diseases related to CHD9 Recombinant Protein (H00080205-P01).
 

Pathways for CHD9 Recombinant Protein (H00080205-P01)

View related products by pathway.

Blogs on CHD9

There are no specific blogs for CHD9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CHD9 Antibody
NB100-60419

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CHD9 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CHD9