CHAC1 Antibody - Azide and BSA Free

Western Blot: CHAC1 Antibody [NBP3-05047] - Analysis of Mouse stomach, using CHAC1 antibody at 1:900 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 60s.

Immunohistochemistry-Paraffin-CHAC1 Antibody [NBP3-05047] -Analysis of CHAC1 in paraffin-embedded human small intestine tissue using CHAC1 Rabbit pAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry-Paraffin-CHAC1 Antibody [NBP3-05047] - Analysis of CHAC1 in paraffin-embedded mouse testis tissue using CHAC1 Rabbit pAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry-Paraffin-CHAC1 Antibody [NBP3-05047] -Rat kidney tissue using CHAC1 Rabbit pAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: CHAC1 Antibody - Azide and BSA Free [NBP3-05047] - Immunofluorescence analysis of paraffin-embedded Human pancreas tissue using CHAC1 Rabbit pAb (A15584) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CHAC1 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit CHAC1 Antibody - Azide and BSA Free (NBP3-05047) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-222 of human CHAC1 (NP_077016.3). MKQESAAPNTPPTSQSPTPSAQFPRNDGDPQALWIFGYGSLVWRPDFAYSDSRVGFVRGYSRRFWQGDTFHRGSDKMPGRVVTLLEDHEGCTWGVAYQVQGEQVSKALKYLNVREAVLGGYDTKEVTFYPQDAPDQPLKALAYVATPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQDEHLAAIVDAVGTMLPCFCPTEQALALV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CHAC1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 24 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for CHAC1 Antibody - Azide and BSA Free

• cation transport regulator-like protein 1
• ChaC, cation transport regulator homolog 1 (E. coli)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CHAC1