CHAC1 Antibody

Images

 
Immunohistochemistry: CHAC1 Antibody [NBP2-30433] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CHAC1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: TLLEDHEGCTWGVAYQVQGEQVSKALKYLNVREAVLGGYDTKEVTFYPQDAPDQPLKALAYVATPQNPGY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHAC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CHAC1 Protein (NBP2-30433PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CHAC1 Antibody

  • cation transport regulator-like protein 1
  • ChaC, cation transport regulator homolog 1 (E. coli)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85816
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
H00000468-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF1457
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NB100-80861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85641
Species: Hu
Applications: IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85367
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-43728
Species: Hu
Applications: WB, ICC/IF
126-FL/CF
Species: Hu
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
AF5510
Species: Hu
Applications: WB
NLS139
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32599
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CHAC1 Antibody (NBP2-30433) (0)

There are no publications for CHAC1 Antibody (NBP2-30433).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHAC1 Antibody (NBP2-30433) (0)

There are no reviews for CHAC1 Antibody (NBP2-30433). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CHAC1 Antibody (NBP2-30433) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CHAC1 Products

Bioinformatics Tool for CHAC1 Antibody (NBP2-30433)

Discover related pathways, diseases and genes to CHAC1 Antibody (NBP2-30433). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHAC1 Antibody (NBP2-30433)

Discover more about diseases related to CHAC1 Antibody (NBP2-30433).
 

Pathways for CHAC1 Antibody (NBP2-30433)

View related products by pathway.

PTMs for CHAC1 Antibody (NBP2-30433)

Learn more about PTMs related to CHAC1 Antibody (NBP2-30433).

Blogs on CHAC1

There are no specific blogs for CHAC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CHAC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHAC1
Uniprot