cGK2/PRKG2 Antibody

Images

 
Immunohistochemistry-Paraffin: cGK2/PRKG2 Antibody [NBP1-84497] - Staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

cGK2/PRKG2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:REYHLKELREQLSKQTVAIAELTEELQNKCIQLNKLQDVVHMQGGSPLQASPDKVPLEVHRKTSGLVSLHSRRGAKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDMVE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRKG2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
cGK2/PRKG2 Protein (NBP1-84497PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for cGK2/PRKG2 Antibody

  • cGK 2
  • cGKIIcGK2
  • cGMP-dependent protein kinase 2
  • cGMP-dependent protein kinase II
  • EC 2.7.11
  • PRKGR2EC 2.7.11.12
  • protein kinase, cGMP-dependent, type II

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02521
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-89724
Species: Hu
Applications: WB, IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
AF3075
Species: Hu
Applications: WB, ICC
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NBP1-90300
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-47470
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-2450
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
H00002981-T01
Species: Hu
PPS007
Species: Hu, Mu, Rt, Ca, Ch
Applications: WB
NB110-81529
Species: Hu, Mu, Rt, Op, Pm, Rb
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IP, IF
NB300-536
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP, IF
NBP2-46617
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-81788
Species: Hu
Applications: IHC, IHC-P
NBP2-00555
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP1-84497
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for cGK2/PRKG2 Antibody (NBP1-84497) (0)

There are no publications for cGK2/PRKG2 Antibody (NBP1-84497).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for cGK2/PRKG2 Antibody (NBP1-84497) (0)

There are no reviews for cGK2/PRKG2 Antibody (NBP1-84497). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for cGK2/PRKG2 Antibody (NBP1-84497) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional cGK2/PRKG2 Products

Bioinformatics Tool for cGK2/PRKG2 Antibody (NBP1-84497)

Discover related pathways, diseases and genes to cGK2/PRKG2 Antibody (NBP1-84497). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for cGK2/PRKG2 Antibody (NBP1-84497)

Discover more about diseases related to cGK2/PRKG2 Antibody (NBP1-84497).
 

Pathways for cGK2/PRKG2 Antibody (NBP1-84497)

View related products by pathway.

PTMs for cGK2/PRKG2 Antibody (NBP1-84497)

Learn more about PTMs related to cGK2/PRKG2 Antibody (NBP1-84497).
 

Research Areas for cGK2/PRKG2 Antibody (NBP1-84497)

Find related products by research area.

Blogs on cGK2/PRKG2

There are no specific blogs for cGK2/PRKG2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our cGK2/PRKG2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKG2