Cerberus 1 Antibody - BSA Free

Staining of human cerebral cortex shows no positivity as expected.

Staining of human duodenum shows strong cytoplasmic positivity in lymphocytes.

Staining of human epididymis shows strong cytoplasmic positivity in lymphocytes.

Staining of human kidney shows strong cytoplasmic positivity in lymphocytes.

Staining of human endometrium shows strong cytoplasmic positivity in lymphocytes.

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Cerberus 1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SDSEPFPPGTQSLIQPIDGMKMEKSPLREEAKKFWHHFMFRKTPASQGVILPIKSHEVHWETCRTVPFSQTITHEGCEKVVVQNNL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CER1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Cerberus 1 Protein (NBP1-88030PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Cerberus 1 Antibody - BSA Free

• CER1
• cerberus 1 (Xenopus laevis) homolog (cysteine knot superfamily)
• Cerberus 1
• cerberus 1, cysteine knot superfamily, homolog (Xenopus laevis)
• cerberus
• cerberus-related 1
• Cerberus-related protein
• DAN domain family member 4
• DAND4
• MGC119894
• MGC119895
• MGC96951

Background

Cerberus encodes a cytokine member of the cysteine knot superfamily, characterized by nine conserved cysteines and a cysteine knot region. The cerberus-related cytokines, together with Dan and DRM/Gremlin, represent a group of bone morphogenetic protein (BMP) antagonists that can bind directly to BMPs and inhibit their activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CER1