Centaurin alpha 1 Antibody - BSA Free

Analysis in human cerebral cortex and skeletal muscle tissues using HPA012049 antibody. Corresponding ADAP1 RNA-seq data are presented for the same tissues.

Staining of human Cerebral cortex shows moderate cytoplasmic and nuclear positivity in neuronal cells.

Staining of human Skeletal muscle shows no positivity in myocytes as expected.

Staining of human Cerebellum shows moderate nuclear positivity in Purkinje cells.

Staining of human Tonsil shows very weak cytoplasmic positivity in non-germinal center cells.

• Reactivity: Hu, Mu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Centaurin alpha 1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Centaurin alpha 1 Antibody - BSA Free (NBP1-88098) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LGVFICLSCSGIHRNIPQVSKVKSVRLDAWEEAQVEFMASHGNDAARARFESKVPSFYYRPTPSDCQLLREQWIRAKYERQEFIYPEKQEPYSAGYREGFLWKRG
• Predicted Species: Mouse (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADAP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: HIER pH6 retrieval is recommended.
• Control Peptide:

  Centaurin alpha 1 Protein (NBP1-88098PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Centaurin alpha 1 Antibody - BSA Free

• arf-GAP with dual PH domain-containing protein 1
• ArfGAP with dual PH domains 1
• CENTA1centaurin-alpha-1
• centaurin, alpha 1
• centaurin-alpha
• Centaurin-alpha-1
• cnt-a1
• GCS1L
• p42IP4
• Putative MAPK-activating protein PM25

Background

The centaurin alpha 1 protein is a high affinity PtdIns(3,4,5)P3 binding protein enriched in brain. By acting as a GTPase activating protein for ADP ribosylation factor 6 (ARF6), centaurin alpha 1 is able to switch off ARF6 and inhibit its ability to mediate beta 2 adrenoceptor internalization and negatively regulates ARF6 activity by functioning as an in vivo PIP3 dependent ARF6 GAP.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADAP1