CENPF Recombinant Protein Antigen

Images

 
There are currently no images for CENPF Recombinant Protein Antigen (NBP2-56124PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CENPF Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CENPF.

Source: E. coli

Amino Acid Sequence: CISELSFSGPNALVPMDFLGNQEDIHNLQLRVKETSNENLRLLHVIEDRDRKVESLLNEMKELDSKLHLQEVQLMTKIEACIELEKIVGELKKENSDLSEKLEYFSCDHQEL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CENPF
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56124.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CENPF Recombinant Protein Antigen

  • AH antigen
  • cell-cycle-dependent 350K nuclear protein
  • CENF
  • CENP-F kinetochore protein
  • CENP-F
  • centromere protein F (350/400kD, mitosin)
  • centromere protein F
  • centromere protein F, 350/400ka (mitosin)
  • centromere protein F, 350/400kDa (mitosin)
  • hcp-1
  • Kinetochore protein CENPF
  • mitosin
  • PRO1779

Background

CENPF (Centromere protein F) is required for proper chromosome segregation in mitosis, and has a cell-cycle distribution that is both temporally regulated and diverse in terms of the structural component localization. Specifically, CENPF is a component of the nuclear matrix during the G2 phase of interphase. In late G2, it associates with the kinetochore and maintains this association through early anaphase. Here, CENPF is required for kinetochore function and appears to be the earliest member to interact with the centromere-kinetochore complex. It then localizes to the spindle midzone in late anaphase and to the intracellular bridge in telophase, where the protein is subsequently degraded. Given this diversity of function, CENPF is expected to play an important role in several mitotic events.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82875
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
MAB6495
Species: Hu
Applications: ICC, Simple Western, WB
AF6000
Species: Hu, Mu
Applications: IHC, Simple Western, WB
NB100-353
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
H00000699-D01P
Species: Hu, Mu
Applications: ICC/IF, PLA, WB
H00051053-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-01086
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-87769
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-33714
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP2-67766
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-34062
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-88089
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-06603
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-32775
Species: Hu, Mar, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-56124PEP
Species: Hu
Applications: AC

Publications for CENPF Recombinant Protein Antigen (NBP2-56124PEP) (0)

There are no publications for CENPF Recombinant Protein Antigen (NBP2-56124PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CENPF Recombinant Protein Antigen (NBP2-56124PEP) (0)

There are no reviews for CENPF Recombinant Protein Antigen (NBP2-56124PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CENPF Recombinant Protein Antigen (NBP2-56124PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CENPF Products

Research Areas for CENPF Recombinant Protein Antigen (NBP2-56124PEP)

Find related products by research area.

Blogs on CENPF.

CENPF: At the Center-o'-mere Mitotic Division (Infographic)
Centromere protein F (CENPF) also known as Mitosin, AH antigen, and kinetochore protein CENPF, is a protein that associates with the centromere-kinetochore complex. CENPF forms both a homodimer and a heterodimer. CENPF can be found in different cellul...  Read full blog post.

CENPF Antibodies as Potential Cancer Markers
Centromere protein F (CENPF), also named mitosin, is a large human protein of 3113 amino acid residues. Its expression and localization are cell cycle-dependent. The protein levels are low in G1 phase but elevated from S to early M phase. CENPF is a n...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CENPF Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CENPF