CENPF Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

CENPF Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CENPF.
  
  

  Source: E. coli

  Amino Acid Sequence: CISELSFSGPNALVPMDFLGNQEDIHNLQLRVKETSNENLRLLHVIEDRDRKVESLLNEMKELDSKLHLQEVQLMTKIEACIELEKIVGELKKENSDLSEKLEYFSCDHQEL

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: CENPF
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56124.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 31 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CENPF Recombinant Protein Antigen

• AH antigen
• cell-cycle-dependent 350K nuclear protein
• CENF
• CENP-F kinetochore protein
• CENP-F
• centromere protein F (350/400kD, mitosin)
• centromere protein F
• centromere protein F, 350/400ka (mitosin)
• centromere protein F, 350/400kDa (mitosin)
• hcp-1
• Kinetochore protein CENPF
• mitosin
• PRO1779

Background

CENPF (Centromere protein F) is required for proper chromosome segregation in mitosis, and has a cell-cycle distribution that is both temporally regulated and diverse in terms of the structural component localization. Specifically, CENPF is a component of the nuclear matrix during the G2 phase of interphase. In late G2, it associates with the kinetochore and maintains this association through early anaphase. Here, CENPF is required for kinetochore function and appears to be the earliest member to interact with the centromere-kinetochore complex. It then localizes to the spindle midzone in late anaphase and to the intracellular bridge in telophase, where the protein is subsequently degraded. Given this diversity of function, CENPF is expected to play an important role in several mitotic events.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: CENPF