CDX4 Antibody

Images

 
Immunohistochemistry: Cdx4 Antibody [NBP2-31643] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CDX4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RAKERKMIKKKISQFENSGGSVQSDSDSISPGELPNTFFTTPSAVRGFQPIEIQQVIVSE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDX4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CDX4 Protein (NBP2-31643PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CDX4 Antibody

  • caudal type homeo box transcription factor 4
  • caudal type homeobox 4
  • caudal type homeobox transcription factor 4
  • Caudal-type homeobox protein 4
  • CDX4
  • homeobox protein CDX-4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2136
Species: Hu
Applications: IHC, IHC-P, IP
NBP1-49538
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-01488
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
423-F8/CF
Species: Hu, Mu
NBP2-24561
Species: Hu, Mu, Rt, Bv, Fe, Pm
Applications: WB, IHC-P
AF6116
Species: Hu
Applications: WB, ICC
NBP2-58252
Species: Hu
Applications: WB, ICC/IF
NBP2-14076
Species: Hu
Applications: IHC, IHC-P
NBL1-11664
Species: Hu
NBP2-48693
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB17791
Species: Hu, Mu
Applications: WB
AF6014
Species: Hu, Mu, Rt
Applications: WB
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
AF2419
Species: Hu
Applications: WB, Simple Western, IHC, ICC

Publications for CDX4 Antibody (NBP2-31643) (0)

There are no publications for CDX4 Antibody (NBP2-31643).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDX4 Antibody (NBP2-31643) (0)

There are no reviews for CDX4 Antibody (NBP2-31643). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CDX4 Antibody (NBP2-31643) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CDX4 Products

Bioinformatics Tool for CDX4 Antibody (NBP2-31643)

Discover related pathways, diseases and genes to CDX4 Antibody (NBP2-31643). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDX4 Antibody (NBP2-31643)

Discover more about diseases related to CDX4 Antibody (NBP2-31643).
 

Pathways for CDX4 Antibody (NBP2-31643)

View related products by pathway.

PTMs for CDX4 Antibody (NBP2-31643)

Learn more about PTMs related to CDX4 Antibody (NBP2-31643).

Blogs on CDX4

There are no specific blogs for CDX4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDX4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDX4
Entrez
Uniprot