NAP1L2 Antibody

Images

 
Western Blot: NAP1L2 Antibody [NBP2-58252] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: NAP1L2 Antibody [NBP2-58252] - Staining of human cell line U-2 OS shows localization to cytosol.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NAP1L2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FSPHGITSNGRDGNDDFLLGHNLRTYIIPRSVLFFSGDALESQQEGVVREVNDAIYDKIIYDNWMAAIEEVKACCKNLEALVEDID
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NAP1L2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NAP1L2 Recombinant Protein Antigen (NBP2-58252PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for NAP1L2 Antibody

  • BPXMGC26243
  • brain specific gene BPX
  • Brain-specific protein, X-linked
  • nucleosome assembly protein 1-like 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2807
Species: Hu
Applications: WB, IHC
NBP1-81162
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-07996
Species: Hu
NBP1-90058
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP2-14424
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00004675-D01P
Species: Hu
Applications: WB, ICC/IF
NBP2-24727
Species: Hu, Mu, Ca
Applications: WB, ICC/IF
NBP2-37252
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP2-36543
Species: Hu
Applications: WB, IP
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83269
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88924
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-68133
Species: Hu
Applications: WB, IHC, IHC-P
AF1152
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-58252
Species: Hu, Mu
Applications: WB, ICC/IF

Publications for NAP1L2 Antibody (NBP2-58252) (0)

There are no publications for NAP1L2 Antibody (NBP2-58252).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NAP1L2 Antibody (NBP2-58252) (0)

There are no reviews for NAP1L2 Antibody (NBP2-58252). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NAP1L2 Antibody (NBP2-58252) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NAP1L2 Products

Bioinformatics Tool for NAP1L2 Antibody (NBP2-58252)

Discover related pathways, diseases and genes to NAP1L2 Antibody (NBP2-58252). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NAP1L2 Antibody (NBP2-58252)

Discover more about diseases related to NAP1L2 Antibody (NBP2-58252).
 

Pathways for NAP1L2 Antibody (NBP2-58252)

View related products by pathway.

PTMs for NAP1L2 Antibody (NBP2-58252)

Learn more about PTMs related to NAP1L2 Antibody (NBP2-58252).
 

Research Areas for NAP1L2 Antibody (NBP2-58252)

Find related products by research area.

Blogs on NAP1L2

There are no specific blogs for NAP1L2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NAP1L2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NAP1L2