CDT2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CDT2 Antibody [NBP2-58216] - Staining of human cell line U-2 OS shows localization to nucleus & cytosol.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CDT2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AGDLPLPSNTPTFSIKTSPAKARSPINRRGSVSSVSPKPPSSFKMSIRNWVTRTPSSSPPITPPASETKIMSPRKALIPVSQKSSQA
Specificity
Specificity of human CDT2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DTL
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CDT2 Recombinant Protein Antigen (NBP2-58216PEP)

Reactivity Notes

Mouse 85%, Rat 86%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CDT2 Antibody

  • CDT2RA-regulated nuclear matrix-associated protein
  • CDW1
  • DCAF2DDB1 and CUL4 associated factor 2
  • DDB1- and CUL4-associated factor 2
  • denticleless homolog (Drosophila)
  • L2DTLRA regulated nuclear matrix associated protein
  • Lethal(2) denticleless protein homolog
  • RAMPdenticleless protein homolog
  • Retinoic acid-regulated nuclear matrix-associated protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS6731
Species: Hu, Rt, Po, Bv, Ca, Eq, Gt, Ha, Mk, Pm, Rb, Xp
Applications: IHC-P
AF6428
Species: Hu
Applications: WB, IHC
NBP2-01853
Species: Hu, Mk
Applications: WB, Flow, IHC, IHC-P
MAB6108
Species: Hu
Applications: IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-86614
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4875
Species: Hu
Applications: WB
NBP2-55298
Species: Hu
Applications: WB, IHC, IHC-P
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB1207
Species: Hu
Applications: WB, Flow, CyTOF-ready
MAB4614
Species: Hu
Applications: Flow, CyTOF-ready
H00003757-Q01
Species: Hu
NBP1-91269
Species: Hu, Mu
Applications: ICC/IF (-), IHC (-), WB
NB100-2567
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50113
Species: Hu
Applications: WB, ICC/IF, IHC, IP

Publications for CDT2 Antibody (NBP2-58216) (0)

There are no publications for CDT2 Antibody (NBP2-58216).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDT2 Antibody (NBP2-58216) (0)

There are no reviews for CDT2 Antibody (NBP2-58216). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CDT2 Antibody (NBP2-58216) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CDT2 Antibody (NBP2-58216)

Discover related pathways, diseases and genes to CDT2 Antibody (NBP2-58216). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDT2 Antibody (NBP2-58216)

Discover more about diseases related to CDT2 Antibody (NBP2-58216).
 

Pathways for CDT2 Antibody (NBP2-58216)

View related products by pathway.

PTMs for CDT2 Antibody (NBP2-58216)

Learn more about PTMs related to CDT2 Antibody (NBP2-58216).
 

Research Areas for CDT2 Antibody (NBP2-58216)

Find related products by research area.

Blogs on CDT2

There are no specific blogs for CDT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DTL