We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

CDS1 Recombinant Protein Antigen

Images

 
There are currently no images for CDS1 Protein (NBP1-85894PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CDS1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDS1.

Source: E. coli

Amino Acid Sequence: YQYFVCPVEYRSDVNSFVTECEPSELFQLQTYSLPPFLKAVLRQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CDS1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85894.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CDS1 Recombinant Protein Antigen

  • CDP-DAG synthase 1
  • CDP-DG synthase 1
  • CDP-DG synthetase 1
  • CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 1
  • CDP-diacylglycerol synthase 1
  • CDP-diglyceride pyrophosphorylase 1
  • CDP-diglyceride synthase 1
  • CDP-diglyceride synthetase 1
  • CDS 1
  • CDS
  • CTP:phosphatidate cytidylyltransferase 1
  • EC 2.7.7.41
  • phosphatidate cytidylyltransferase 1

Background

Breakdown products of phosphoinositides are ubiquitous second messengers that function downstream of many G protein-coupled receptors and tyrosine kinases regulating cell growth, calcium metabolism, and protein kinase C activity. This gene encodes an enzyme which regulates the amount of phosphatidylinositol available for signaling by catalyzing the conversion of phosphatidic acid to CDP-diacylglycerol. This enzyme is an integral membrane protein localized to two subcellular domains, the matrix side of the inner mitochondrial membrane where it is thought to be involved in the synthesis of phosphatidylglycerol and cardiolipin and the cytoplasmic side of the endoplasmic reticulum where it functions in phosphatidylinositol biosynthesis. Two genes encoding this enzyme have been identified in humans, one mapping to human chromosome 4q21 and a second to 20p13. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56546
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-464
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NB100-309
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, KD, PAGE, Single-Cell Western, WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB4459
Species: Hu, Mu, Rt
Applications: WB
NBP1-31541
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-24457
Species: Hu, Mu, Pm
Applications: IHC,  IHC-P, WB
NBP2-27500
Species: Mu
Applications: KO, PEP-ELISA, WB
NB100-308
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-86602
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB100-56585
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF2535
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
NBP1-86435
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-32405
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB120-13600
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-01020
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-81785
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-47833
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for CDS1 Protein (NBP1-85894PEP) (0)

There are no publications for CDS1 Protein (NBP1-85894PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDS1 Protein (NBP1-85894PEP) (0)

There are no reviews for CDS1 Protein (NBP1-85894PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CDS1 Protein (NBP1-85894PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CDS1 Products

Array NBP1-85894PEP

Research Areas for CDS1 Protein (NBP1-85894PEP)

Find related products by research area.

Blogs on CDS1

There are no specific blogs for CDS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CDS1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CDS1