Recombinant Human Cdk9 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Cdk9 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-102 of Human CDK9 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:QKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CDK9
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Cdk9 Protein

  • C-2k
  • CDC2L4CTK1
  • CDC2-related kinase
  • Cell division cycle 2-like protein kinase 4
  • Cell division protein kinase 9
  • cyclin-dependent kinase 9 (CDC2-related kinase)
  • cyclin-dependent kinase 9
  • EC 2.7.11
  • EC 2.7.11.22
  • EC 2.7.11.23
  • PITALRE
  • serine/threonine protein kinase PITALRE
  • Serine/threonine-protein kinase PITALRE
  • TAK

Background

CDK9 - cyclin-dependent kinase 9 (CDC2-related kinase)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00000904-Q01
Species: Hu
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC
46420002
Species: Hu
Applications: WB, ELISA
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB100-581
Species: Hu
Applications: WB, IHC, IP, PLA
NBP1-87592
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88376
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71867
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-06519
Species: Hu
Applications: WB, IHC-P, IP
H00001024-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for Cdk9 Partial Recombinant Protein (H00001025-Q01) (0)

There are no publications for Cdk9 Partial Recombinant Protein (H00001025-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cdk9 Partial Recombinant Protein (H00001025-Q01) (0)

There are no reviews for Cdk9 Partial Recombinant Protein (H00001025-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cdk9 Partial Recombinant Protein (H00001025-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cdk9 Products

Bioinformatics Tool for Cdk9 Partial Recombinant Protein (H00001025-Q01)

Discover related pathways, diseases and genes to Cdk9 Partial Recombinant Protein (H00001025-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cdk9 Partial Recombinant Protein (H00001025-Q01)

Discover more about diseases related to Cdk9 Partial Recombinant Protein (H00001025-Q01).
 

Pathways for Cdk9 Partial Recombinant Protein (H00001025-Q01)

View related products by pathway.

PTMs for Cdk9 Partial Recombinant Protein (H00001025-Q01)

Learn more about PTMs related to Cdk9 Partial Recombinant Protein (H00001025-Q01).
 

Research Areas for Cdk9 Partial Recombinant Protein (H00001025-Q01)

Find related products by research area.

Blogs on Cdk9

There are no specific blogs for Cdk9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Cdk9 Antibody
NB120-10874

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Cdk9 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CDK9