Cdk7 Antibody - BSA Free

Western Blot: Cdk7 Antibody [NBP1-86666] - Analysis in human cell lines Caco-2 and MCF-7 using anti-CDK7 antibody. Corresponding CDK7 RNA-seq data are presented for the same cell lines. Loading control: anti-PPIB.

Immunohistochemistry-Paraffin: Cdk7 Antibody [NBP1-86666] - Staining in human testis and liver tissues using NBP1-86666 antibody. Corresponding CDK7 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Cdk7 Antibody [NBP1-86666] - Staining of human cerebellum shows moderate nuclear positivity in Purkinje cells.

Immunohistochemistry-Paraffin: Cdk7 Antibody [NBP1-86666] - Staining of human liver shows very weak positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: Cdk7 Antibody [NBP1-86666] - Staining of human placenta shows moderate to strong nuclear positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: Cdk7 Antibody [NBP1-86666] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Analysis in human cell lines Caco-2 and MCF-7 using Anti-CDK7 antibody. Corresponding CDK7 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.

• Reactivity: Hu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Cdk7 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLI
• Predicted Species: Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CDK7
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Cdk7 Protein (NBP1-86666PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Cdk7 Antibody - BSA Free

• CAK1Xenopus laevis, cdk-activating kinase)
• Cdk7
• CDK-activating kinase
• CDKN7
• Cell division protein kinase 7
• cyclin-dependent kinase 7 (homolog of Xenopus MO15 cdk-activating kinase)
• cyclin-dependent kinase 7
• EC 2.7.11
• EC 2.7.11.22
• EC 2.7.11.23
• EC 2.7.11.24
• MO15
• p39 Mo15
• serine/threonine kinase stk1,39 kDa protein kinase
• serine/threonine protein kinase 1
• serine/threonine protein kinase MO15
• STK1
• TFIIH basal transcription factor complex kinase subunit

Background

Cdk7 is encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This protein forms a trimeric complex with cyclin H and MAT1, which functions as a Cdk-activating kinase (CAK). It is an essential component of the transcription factor TFIIH, that is involved in transcription initiation and DNA repair. This protein is thought to serve as a direct link between the regulation of transcription and the cell cycle.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CDK7