CDK5RAP3 Antibody

Images

 
Western Blot: CDK5RAP3 Antibody [NBP1-86780] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: CDK5RAP3 Antibody [NBP1-86780] - Staining of human cell line U-2 OS shows localization to nucleoli & cytosol.
Immunohistochemistry-Paraffin: CDK5RAP3 Antibody [NBP1-86780] - Staining of human epididymis shows strong cytoplasmic positivity in glandular cells.
Western Blot: CDK5RAP3 Antibody [NBP1-86780] - Analysis in human cell line MCF-7.
Immunohistochemistry-Paraffin: CDK5RAP3 Antibody [NBP1-86780] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CDK5RAP3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LIGKLTSLQLQHLFMILASPRYVDRVTEFLQQKLKQSQLLALKKELMVQKQQEALEEQAALEPKLDLLLEKTKELQKLIEADISKRYSGRPVNLMGTSL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDK5RAP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CDK5RAP3 Protein (NBP1-86780PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CDK5RAP3 Antibody

  • C53
  • CDK5 activator-binding protein C53
  • CDK5 regulatory subunit associated protein 3
  • FLJ13660
  • HSF-27
  • IC53CDK5 regulatory subunit-associated protein 3
  • ischemic heart CDK5 activator-binding protein C53
  • LXXLL/leucine-zipper-containing ARFbinding protein
  • LZAP
  • MST016
  • OK/SW-cl.114
  • Protein HSF-27

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF7250
Species: Hu
Applications: IHC
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-90692
Species: Hu
Applications: WB, IHC, IHC-P, KO
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-88308
Species: Hu
Applications: IHC, IHC-P
NBP2-49530
Species: Hu
Applications: WB, ICC/IF, IHC
NBP2-15844
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59027
Species: Hu
Applications: ICC/IF, IHC-P
AF2428
Species: Hu
Applications: WB
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-92564
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91931
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3770
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for CDK5RAP3 Antibody (NBP1-86780) (0)

There are no publications for CDK5RAP3 Antibody (NBP1-86780).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDK5RAP3 Antibody (NBP1-86780) (0)

There are no reviews for CDK5RAP3 Antibody (NBP1-86780). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CDK5RAP3 Antibody (NBP1-86780) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CDK5RAP3 Products

Bioinformatics Tool for CDK5RAP3 Antibody (NBP1-86780)

Discover related pathways, diseases and genes to CDK5RAP3 Antibody (NBP1-86780). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDK5RAP3 Antibody (NBP1-86780)

Discover more about diseases related to CDK5RAP3 Antibody (NBP1-86780).
 

Pathways for CDK5RAP3 Antibody (NBP1-86780)

View related products by pathway.

PTMs for CDK5RAP3 Antibody (NBP1-86780)

Learn more about PTMs related to CDK5RAP3 Antibody (NBP1-86780).
 

Research Areas for CDK5RAP3 Antibody (NBP1-86780)

Find related products by research area.

Blogs on CDK5RAP3

There are no specific blogs for CDK5RAP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDK5RAP3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDK5RAP3