UFL1 Antibody

Images

 
Western Blot: UFL1 Antibody [NBP1-90692] - Analysis in human cell line Daudi.
Immunohistochemistry-Paraffin: UFL1 Antibody [NBP1-90692] - Staining of human urinary bladder shows cytoplasmic positivity in urothelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P, KO
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UFL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VGQGLVDQVEASVEEAISSGTWVDIAPLLPTSLSVEDAAILLQQVMRAFSKQASTVVFSDTVVVSEKFINDCTELFRELMHQKAEKEMK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UFL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Knockout Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. KO Validation was reported in scientific literature (PMID: 27351204).
Control Peptide
UFL1 Protein (NBP1-90692PEP)
Publications
Read Publication using
NBP1-90692 in the following applications:

  • KO
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UFL1 Antibody

  • E3 UFM1-protein ligase 1
  • EC 6.3.2.-
  • KIAA0776
  • LZAP-binding protein
  • NLBPnovel LZAP-binding protein
  • RP3-393D12.1
  • UFL1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86780
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89680
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-88308
Species: Hu
Applications: IHC, IHC-P
NBP1-82087
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
AF8237
Species: Hu
Applications: WB, ICC
NBP1-51689
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB100-80861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1869
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
MAB6967
Species: Hu
Applications: WB
H00006925-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90692
Species: Hu
Applications: WB, IHC, IHC-P, KO

Publications for UFL1 Antibody (NBP1-90692)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: KO.


Filter By Application
KO
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for UFL1 Antibody (NBP1-90692) (0)

There are no reviews for UFL1 Antibody (NBP1-90692). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UFL1 Antibody (NBP1-90692) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UFL1 Products

Bioinformatics Tool for UFL1 Antibody (NBP1-90692)

Discover related pathways, diseases and genes to UFL1 Antibody (NBP1-90692). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UFL1 Antibody (NBP1-90692)

Discover more about diseases related to UFL1 Antibody (NBP1-90692).
 

Pathways for UFL1 Antibody (NBP1-90692)

View related products by pathway.

PTMs for UFL1 Antibody (NBP1-90692)

Learn more about PTMs related to UFL1 Antibody (NBP1-90692).

Blogs on UFL1

There are no specific blogs for UFL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UFL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UFL1